PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G26770.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 268aa    MW: 28982.2 Da    PI: 9.1297
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G26770.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1056.6e-33172228158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy++Il+RRq+Rak+e ekk+  k+rkpylheSRh+hA+rR+Rg+gGrF
  OMERI03G26770.3 172 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-VKARKPYLHESRHQHAMRRARGTGGRF 228
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.7E-37170231IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.032171231IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-28173228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.7E-25174196IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860176196IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.7E-25205228IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDQFLVGPAS MESRPGGTNL VEPRGQGALP SGIPIQQPWW TTSAGVGAVS PAVVAPGSGA  60
GISLSGRDGG GDDAAEESSD DSRRSGETKD GSTGQEKHHA TSQMTALASD YLTPFSQLEL  120
NQPIASAAYQ YPDSYYMGMV GPYGPQAMSA QTHFQLPGLT HSRMPLPLEI SEEPVYVNAK  180
QYHGILRRRQ SRAKAELEKK VVKARKPYLH ESRHQHAMRR ARGTGGRFLN TKKNEDGAPS  240
EKADPNKGEQ NSGYRRIAPD LQLLQKET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-21172235265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0698540.0AK069854.1 Oryza sativa Japonica Group cDNA clone:J023036P10, full insert sequence.
GenBankEU8470120.0EU847012.1 Oryza sativa Japonica Group clone KCS256D08 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632634.10.0nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015632635.10.0nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015632636.10.0nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015632637.10.0nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLA0A0E0D4Y40.0A0A0E0D4Y4_9ORYZ; Uncharacterized protein
STRINGOMERI03G25970.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82053649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.26e-32nuclear factor Y, subunit A7