PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G24920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 212aa    MW: 21995 Da    PI: 8.8896
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G24920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.36.4e-44401391100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cv+apyfp  +p+kfanvhk+FGasnv+kll+++p ++r da+sslvyeA+ar+rdP+yG+vg i++lqqq+e l+a+l
  OMERI03G24920.1  40 PCAACKLLRRRCAAGCVFAPYFPPGEPHKFANVHKVFGASNVSKLLQEIPVQHRGDAVSSLVYEANARVRDPIYGCVGAISSLQQQVEALQAQL 133
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  OMERI03G24920.1 134 ALAQAE 139
                      **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.74739140IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4340137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MRDVVVAVGG GTKAASRQQG QGQGQGGVTL AAAVGSAASP CAACKLLRRR CAAGCVFAPY  60
FPPGEPHKFA NVHKVFGASN VSKLLQEIPV QHRGDAVSSL VYEANARVRD PIYGCVGAIS  120
SLQQQVEALQ AQLALAQAEM VRLRMSNDYI GRRLRARGCG GGGGGGGSTT TTTGSPSSMS  180
SPAKTAEPEP LCKPTPELDM VVDQPDFGFW SY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC1391740.0AC139174.3 Oryza sativa chromosome 3 BAC OSJNBb0065L20 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629600.11e-108PREDICTED: LOB domain-containing protein 4
SwissprotQ8LBW31e-58LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0E0D4751e-154A0A0E0D475_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013249-PA1e-108(Oryza sativa Indica Group)
STRINGLOC_Os03g45750.11e-108(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-35LOB domain-containing protein 4