PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G24480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 361aa    MW: 37875.4 Da    PI: 9.2856
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G24480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA964.3e-30171227158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d+p+YVNaKQy++Il+RR +Rak+++e++l  k+rkpylheSRh+hA+rR+RgsgGrF
  OMERI03G24480.1 171 DAPIYVNAKQYEGILRRRRARAKAQRENRL-VKGRKPYLHESRHRHAMRRARGSGGRF 227
                      68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.8E-33169230IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.01170230IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.7E-23173195IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-27173227IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.7E-23204227IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MLSFKQSHEG FGHVAAAGAG PQQQQPWWAG SQLLYGEASP EEAALRDGGQ FQVVPGGRAA  60
LDPAAPEPEK TAVPAMPKRG GGGAPEVLKF SVFSGNLEPG DTGEKNREHS ATIAMQSPLP  120
EYNGHFELGL GQSMVSPNYP CIDQCYGLLT TYAMKSMSGG RMLLPLNAPA DAPIYVNAKQ  180
YEGILRRRRA RAKAQRENRL VKGRKPYLHE SRHRHAMRRA RGSGGRFLNT KKEATAGGGS  240
SKTLLASLIS PADVVHRPGS RGGSGGGRAS SLSGSDVSSP GGGMYDHHRH DDAVDAADHY  300
NSIDHHLRTP FFTPLPIIMD GGGGGGGGGD HASHSAATAA VAAPFRWATA AGDGCCELLK  360
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A9e-18171229261HAPB protein
4g92_A9e-18171229261HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1211220RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880340.0AB288034.1 Oryza sativa Japonica Group OsHAP2H mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1063980.0AK106398.1 Oryza sativa Japonica Group cDNA clone:002-102-F12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628114.10.0nuclear transcription factor Y subunit A-10 isoform X2
TrEMBLA0A0E0D4190.0A0A0E0D419_9ORYZ; Uncharacterized protein
STRINGOS03T0647600-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.31e-24nuclear factor Y, subunit A10