PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G23660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 95aa    MW: 11268.2 Da    PI: 10.9643
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G23660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.56.7e-1514822192
                     HH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
               B3 21 kfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92
                     +fa++  ++ ++  + ++ ++ g++W   +++r + +r ++ +GW +Fv++n+L++gD+++F+l  +++ +l
  OMERI03G23660.1 14 RFAAAVHLPDRR--ETVVLQRMGERWATVMQIRSGTRRLLI-SGWHRFVRDNRLRVGDICLFELRTHESWRL 82
                     677777666444..6778889*********88888877655.5********************875554444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.491188IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-151488IPR015300DNA-binding pseudobarrel domain
PfamPF023621.1E-121483IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.4E-171487IPR015300DNA-binding pseudobarrel domain
CDDcd100171.10E-111474No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MIFVCDKIQE LGARFAAAVH LPDRRETVVL QRMGERWATV MQIRSGTRRL LISGWHRFVR  60
DNRLRVGDIC LFELRTHESW RLTMAVHAIF REQCC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1072061e-128AC107206.4 Oryza sativa chromosome 3 BAC OSJNBa0063J18 genomic sequence, complete sequence.
GenBankAP0149591e-128AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-128CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633049.19e-51B3 domain-containing protein Os03g0619600
RefseqXP_015633050.19e-51B3 domain-containing protein Os03g0619600
SwissprotQ6AV228e-52Y3196_ORYSJ; B3 domain-containing protein Os03g0619600
TrEMBLA0A0E0D3R11e-62A0A0E0D3R1_9ORYZ; Uncharacterized protein
STRINGORUFI03G27180.11e-50(Oryza rufipogon)
STRINGORGLA03G0243400.13e-50(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.15e-08B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]