PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G14760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 329aa    MW: 35806 Da    PI: 7.046
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G14760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.8e-10134181552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  OMERI03G14760.1 134 KRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 181
                      9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-14130194IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599132195IPR004827Basic-leucine zipper domain
PfamPF001701.3E-8134180IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11134185No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-8134188No hitNo description
CDDcd147033.92E-22135184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MQEPKHTDPA AMRGAHHRRA RSEVAFRLPD DLDLGGGGAG AFDEIGSEDD LFSTFMDIEK  60
ISSGPAAAGG SDRDRAAETS SPPRPKHRHS SSVDGSGFFA AARKDAAASL AEVMEAKKAM  120
TPEQLSELAA IDPKRAKRIL ANRQSAARSK ERKARYITEL ERKVQTLQTE ATTLSAQLTL  180
FQRDTTGLSA ENAELKIRLQ AMEQQAQLRD ALNDALKQEL ERLKLATGEM TNSNETYSMG  240
LQHVPYNTPF FPLAQHNAAR QNGGTQLPPQ FQPPRPNVPN HMLSHPNGLQ DIMQQDPLGR  300
LQGLDISKGP LVVKSESSSI SASESSSTF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0594730.0AK059473.1 Oryza sativa Japonica Group cDNA clone:001-028-E05, full insert sequence.
GenBankAK0704660.0AK070466.1 Oryza sativa Japonica Group cDNA clone:J023052D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632816.10.0transcription factor RF2b
SwissprotQ6S4P40.0RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0D0520.0A0A0E0D052_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GM270.0A0A0E0GM27_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NUP80.0A0A0E0NUP8_ORYRU; Uncharacterized protein
STRINGORUFI03G17050.10.0(Oryza rufipogon)
STRINGOS03T0336200-020.0(Oryza sativa)
STRINGONIVA03G17500.20.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-72bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]