PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G14250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 358aa    MW: 39200.3 Da    PI: 6.0077
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G14250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.91.4e-55211481129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee+v++yL++k+ +++++   vi evd++k+ePw+Lp+++k +ekewyfF+++d+ky+tg+r+nrat+sgyWkatgkdke+++
  OMERI03G14250.1  21 LPPGFRFHPTDEEIVSHYLTPKALNHRFSS-GVIGEVDLNKCEPWHLPAMAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIFR 113
                      79*************************999.99***************988999**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +g lvg+kktLvfy grap+gekt Wvmhe+rle
  OMERI03G14250.1 114 GRGILVGMKKTLVFYLGRAPRGEKTGWVMHEFRLE 148
                      ********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-6415171IPR003441NAC domain
PROSITE profilePS5100558.4521171IPR003441NAC domain
PfamPF023655.7E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MSEVSVMAEV EETAAAAPLD LPPGFRFHPT DEEIVSHYLT PKALNHRFSS GVIGEVDLNK  60
CEPWHLPAMA KMGEKEWYFF CHKDRKYPTG TRTNRATESG YWKATGKDKE IFRGRGILVG  120
MKKTLVFYLG RAPRGEKTGW VMHEFRLEGK LPSQLPRSAK DQWAVCKVFN KELALAAKNG  180
PMAVTGATAD DARIERVGSF SFLSDFIDPA ELPPLMDPSF VADIDGTDDA KVSASTSGQA  240
AVAAGFHVAS QGMSYQQVKM EEPLPLPYLH QQPPRMLHSG QYFSLPAVHP GDLTPSAIRR  300
YCKAEQVSGQ TSALSASRDT GLSTDPNAAG CAEISSAPTS QPFPEFDDAI LGLDDFWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-55101729169NAC domain-containing protein 19
3swm_B3e-55101729169NAC domain-containing protein 19
3swm_C3e-55101729169NAC domain-containing protein 19
3swm_D3e-55101729169NAC domain-containing protein 19
3swp_A3e-55101729169NAC domain-containing protein 19
3swp_B3e-55101729169NAC domain-containing protein 19
3swp_C3e-55101729169NAC domain-containing protein 19
3swp_D3e-55101729169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1854450.0JN185445.1 Oryza sativa Japonica Group NAC transcription factor 39 (NAC39) mRNA, complete cds.
GenBankAK0659890.0AK065989.1 Oryza sativa Japonica Group cDNA clone:J013046E14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633121.10.0PREDICTED: NAC domain-containing protein 92
TrEMBLA0A0E0CZW80.0A0A0E0CZW8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA010816-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04060.11e-92NAC domain containing protein 46