PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G12370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 239aa    MW: 25517.8 Da    PI: 6.3383
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G12370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.4e-40631621100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCkvlrr+Ca++Cvlapyfp ++p kf  +h++FGasn++kll++lpe+ r da+ss+vyeAear+rdPvyG++g + +lq++ ++lk++l
  OMERI03G12370.1  63 PCAACKVLRRRCADGCVLAPYFPPTEPTKFTTAHRVFGASNIIKLLQELPESARADAVSSMVYEAEARLRDPVYGCAGAVCRLQKEANELKVQL 156
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++ 
  OMERI03G12370.1 157 ARAQAD 162
                      *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.27462163IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4063160IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MDQAGNTVAN VTVAQQPHYG RSVSPPSRVS SCSPPPPPVG TASLLVGNTS SSSSPTTTVV  60
LSPCAACKVL RRRCADGCVL APYFPPTEPT KFTTAHRVFG ASNIIKLLQE LPESARADAV  120
SSMVYEAEAR LRDPVYGCAG AVCRLQKEAN ELKVQLARAQ ADLLNARAQH DNLVALVCVE  180
LAHRRRDDDQ QLEYQAPAPP LPHPAEYCGG GASFGAAVYQ PFYDSDLDSA AWGEPQLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0725150.0AK072515.1 Oryza sativa Japonica Group cDNA clone:J023131K07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629326.11e-173PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR02e-61LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0E0CZ361e-176A0A0E0CZ36_9ORYZ; Uncharacterized protein
STRINGBGIOSGA038947-PA1e-173(Oryza sativa Indica Group)
STRINGLOC_Os03g17810.11e-173(Oryza sativa Japonica Group)
STRINGORGLA03G0128100.11e-173(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-59LOB domain-containing protein 1