PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G06380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 309aa    MW: 33376.5 Da    PI: 4.4473
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G06380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1872124456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      ++++  eq+++Le+ F  +++++ ++++++A+ lgL+ rqV +WFqNrRa++k
  OMERI03G06380.1  72 KRRLALEQVRALERSFDTDNKLNPDRKARIARDLGLQPRQVAIWFQNRRARWK 124
                      4467789*********************************************9 PP

2HD-ZIP_I/II127.27.1e-4170162193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl+ eqv++LE+sF++++kL+p+rK+++ar+Lglqprqva+WFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  OMERI03G06380.1  70 EKKRRLALEQVRALERSFDTDNKLNPDRKARIARDLGLQPRQVAIWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDKDALATEIRE 162
                      69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.59E-1860128IPR009057Homeodomain-like
SMARTSM003891.6E-1869130IPR001356Homeobox domain
PROSITE profilePS5007116.50370126IPR001356Homeobox domain
CDDcd000862.85E-1771127No hitNo description
PfamPF000468.7E-1672124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.7E-1978125IPR009057Homeodomain-like
PRINTSPR000312.5E-597106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000312.5E-5106122IPR000047Helix-turn-helix motif
PfamPF021831.1E-15126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MKRPTSSRKS KKPAGENLAF SEEGSLPAAT MEQQDEAELE VDDDDDEEVD EDMAGVHAAQ  60
SPSPSCGLGE KKRRLALEQV RALERSFDTD NKLNPDRKAR IARDLGLQPR QVAIWFQNRR  120
ARWKTKQLER DFAALRARHD ALRADCDALR RDKDALATEI RELREKLSKP ADTAASVKVE  180
AGNDAAVGAA AATVCKDGSS DDSDSSVVFN DEASPYSGAA FIGFGPQFLV DDASAATVGC  240
SSSLPALESK WHGPYSDDSC KGGVYGFTEE WLAACSGEMA GNDAAGFFSD EHASNLNFGW  300
CASGNEGWE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8310390.0CT831039.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA023E12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628283.11e-179homeobox-leucine zipper protein HOX13 isoform X1
SwissprotQ10QP31e-180HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0E0CWF90.0A0A0E0CWF9_9ORYZ; Uncharacterized protein
STRINGOMERI03G06290.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.17e-28homeobox protein 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]