PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G04970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 354aa    MW: 38505.6 Da    PI: 6.9541
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G04970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.4e-18124177356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  OMERI03G04970.1 124 KKRRLNVEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 177
                      4568999**********************************************9 PP

2HD-ZIP_I/II1291.9e-41123214192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      ekkrrl+ eqv++LE++Fe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da+k+en++L +++++L++e+ 
  OMERI03G04970.1 123 EKKRRLNVEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKAENDALLNHNKKLQAEIV 214
                      69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-19101180IPR009057Homeodomain-like
SuperFamilySSF466891.24E-19114181IPR009057Homeodomain-like
PROSITE profilePS5007117.41119179IPR001356Homeobox domain
SMARTSM003891.2E-17122183IPR001356Homeobox domain
CDDcd000861.16E-16124180No hitNo description
PfamPF000462.1E-15124177IPR001356Homeobox domain
PRINTSPR000311.3E-5150159IPR000047Helix-turn-helix motif
PROSITE patternPS000270154177IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5159175IPR000047Helix-turn-helix motif
PfamPF021834.7E-14179219IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MASNGMASSP SSFFPPNFLL HMAQQQTAPP HDPQEHHHHH HHGHHGHHHE QQHHHHLGPP  60
PPPPPNPHNP FLPSSAQCPS LQEFRGMAPM LGKRPMSYGD GGDEVNGGGG EDELSDDGSQ  120
AGEKKRRLNV EQVRTLEKNF ELGNKLEPER KMQLARALGL QPRQVAIWFQ NRRARWKTKQ  180
LEKDYDALKR QLDAVKAEND ALLNHNKKLQ AEIVALKGRE AASELINLNK ETEASCSNRS  240
ENSSEINLDI SRTPPPDAAP TAHHHHHGGG GSGGMIPFYT SIARPASGGG VDIDQLLHSS  300
SGGAGGPKME HHGGGGGGGN VQAASVDTAS FGNLLCGVDE PPPFWPWPDH QHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171179RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1444910.0AC144491.1 Oryza sativa Japonica Group chromosome 3 clone OSJNAa0091P11, complete sequence.
GenBankAC0735560.0AC073556.11 Oryza sativa chromosome 3 BAC OSJNBa0091P11 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629266.10.0PREDICTED: homeobox-leucine zipper protein HOX21
SwissprotQ8S7W90.0HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLA0A0E0CVU50.0A0A0E0CVU5_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g07450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.17e-76HD-ZIP family protein