PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G02220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 402aa    MW: 42431.2 Da    PI: 7.9409
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G02220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.9e-322174255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  OMERI03G02220.1 21 PRLRWTPDLHHCFVHAIHKLGGQDKATPKRVLQLMGVGGLTISHVKSHLQMYRN 74
                     8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-311777IPR009057Homeodomain-like
PROSITE profilePS5129412.6531777IPR017930Myb domain
SuperFamilySSF466897.35E-161976IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-242174IPR006447Myb domain, plants
PfamPF002498.0E-102273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MVGGGRERNG GVRQYNRSKV PRLRWTPDLH HCFVHAIHKL GGQDKATPKR VLQLMGVGGL  60
TISHVKSHLQ MYRNMRNDLG MQGIQVDQEH TYGGGVEVWT DMQQCDHDEC DVPCCSCHSP  120
KPRKEPLLHL QLKSSGMNID EPGTRARIAA PNVRSCRDDA AASETETRRR RGGRPEEEDD  180
DANASASPRT SQLQLLRLRG HGIRESDMSS SPPSTSLRCY YVRSQRTTTT MPPGAAAAAA  240
GGDGGSQCYA APRYSSSSKL KFLGFVVTSG PPPPPPRLPP PAAACCCGSD DNIPFQVGTF  300
HQHRVAPPTA SCGGGGRAEA RPSSYRSVWF EPAAAAGAAA SNNGVAPDGE HDDGCSLSLS  360
LALDTGCGGA GAGADGSLVS STTSSSSGSR ISLDLSLSTL DS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-182276357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-182276357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-182276357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-182276357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025880094.10.0uncharacterized protein LOC4331498 isoform X1
TrEMBLA0A0E0CUN20.0A0A0E0CUN2_9ORYZ; Uncharacterized protein
STRINGOMERI03G02220.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.14e-26G2-like family protein