PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G34900.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 836aa    MW: 92586.5 Da    PI: 4.9044
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G34900.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.47.5e-24646690145
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                      kpr+rWtpeLHerFv+av++LGGsekAtPk++ ++mkv++Lt++h
  OMERI02G34900.4 646 KPRMRWTPELHERFVDAVNKLGGSEKATPKAVQKIMKVDSLTIYH 690
                      79*****************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF111072.1E-461211No hitNo description
PfamPF111071.2E-18218347No hitNo description
SuperFamilySSF466893.4E-10643690IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-20645690IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-16646689IPR006447Myb domain, plants
PfamPF002491.1E-5648685IPR001005SANT/Myb domain
PfamPF143794.2E-18728770IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 836 aa     Download sequence    Send to blast
MEELLGLVRG FVDVLVLAGG RTSSGAAATW RSGDVKKALQ WALFFEEVFK NLRDDGQYDE  60
SARELDAALV QLTSSPNFPK GIEDIRSKTL ATARELVLKH FLKTTNAENL GAVLQAVVEM  120
DMDGISASGE RSVCQEYVQS ILDMNLPSLM RTKNACDVGY STSSDEFCEE SLFMGNSQIL  180
LKELQKKLDS GSCISLAERE LNTLLKSMKK DSFDSAGSTL CTSATAQKTQ IVDKFILWKQ  240
WKAKCLLYLL DERTIRIMSG TNLIFNAPKE QWMGLFEPLK VSADSSQSGI IEVMELCLLG  300
LVARQWNSLI ESFMSHTFSS FPISKQYADL HQLLQGTTQD ECQDKLLGFK EMDICEYARQ  360
SLESEPYILW LLPPVLTAAA MPPRSSLFKI YLVEIDKQLG EAGSKDRPTS TMNQLRNGKV  420
PQYLSPAITV VPALSEVAFP SFSEHRPSYI EREQCGSSIN SFDPSTPMCM LASNFTSDLY  480
INNSESPNGK LSSESYAIDT SGCDSSLPQQ SLYKGNPNSL RMVYPKVSEQ NSWSQEPLPG  540
PFVCPTSVDF FDQQDMAIFD QQIQDNIAAS PRTNLAKQNE WFSSGTSLQY LESSVSAGSV  600
LKAADATSTT PSNYSHCHAQ RNTSNPPNFN ELCSGNIASS NIAPTKPRMR WTPELHERFV  660
DAVNKLGGSE KATPKAVQKI MKVDSLTIYH KYRTVHHRPQ LSDGESAKSG QMDEVSSQPL  720
KGMETTCEGL RVQIGLQKQL HEQLEIQRKL QLQVEEHSKY LAMIIEKQSE SLRQLGALPR  780
SLDAPTQVLD NRETCEGQTG DADSAEQKPE KGMHNLEISE ETPYAGSLAA GSDNQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-20646698260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0663820.0AK066382.1 Oryza sativa Japonica Group cDNA clone:J013064K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0CT100.0A0A0E0CT10_9ORYZ; Uncharacterized protein
STRINGOMERI02G34190.30.0(Oryza meridionalis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-40phosphate starvation response 1