PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G32760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 395aa    MW: 43414.8 Da    PI: 11.4891
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G32760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.22.4e-32222278158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d p+YVN+KQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+Rg+gGrF
  OMERI02G32760.1 222 DGPIYVNPKQYHGILRRRQLRAKLEAQNKL-VKTRKPYLHESRHRHAMKRARGTGGRF 278
                      57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-37220281IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.735221281IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-28224278IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.9E-24224246IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.9E-24255278IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MPRRSPRLPP PQYSWFAAAA AASSSRCLPL AVSSQYPDQP GARGLPLRSY PGLRRRILLN  60
PIMESHEEAS LGTRRRIKEH PPVGMMQSRG AAAEATAGRS RGGCRRSEQQ QQQQLLRAAE  120
APREEVRGSH ASPLIVFFFL RLQRRTVDGP MRSTLTFDNN HSVVPSQNID YGQPMACISY  180
PYNDSGSGVW ASYSSRSAFH PQIVGGGTSP RVPLPSLEIA DDGPIYVNPK QYHGILRRRQ  240
LRAKLEAQNK LVKTRKPYLH ESRHRHAMKR ARGTGGRFLN TKQLQLQQQS HTTSTKTTTD  300
SQNSSGSVHL RLGGGAIGDQ TSFKFKAMDS QANIKRAAAS ASTFTVTSAA QKDDAFYDRH  360
GHHLSSFSGH FGQASAQGGV GSMHNGSQQR VPAMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-20222283263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1262271RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185740.0AK318574.1 Oryza sativa Japonica Group cDNA, clone: J090045B17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623432.10.0nuclear transcription factor Y subunit A-4
TrEMBLA0A0E0CS640.0A0A0E0CS64_9ORYZ; Uncharacterized protein
STRINGOMERI02G31990.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132762833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-29nuclear factor Y, subunit A5