PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G32150.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 358aa    MW: 38118.4 Da    PI: 9.5154
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G32150.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-15278326553
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                      +r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ +e+ 
  OMERI02G32150.2 278 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEML 326
                      79***************************************98876643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-14274339IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.197276328IPR004827Basic-leucine zipper domain
CDDcd147076.90E-24278330No hitNo description
Gene3DG3DSA:1.20.5.1708.6E-15278329No hitNo description
SuperFamilySSF579597.88E-11278328No hitNo description
PfamPF001702.7E-13278328IPR004827Basic-leucine zipper domain
PROSITE patternPS000360281296IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MDFPGGSGRQ QQQLPPMTPL PLARQGSVYS LTFDEFQSTL GGVGKDFGSM NMDELLRSIW  60
TAEESHAVGA ATTTTATTAS VAAAEHAAVG AAPVQRQGSL TLPRTLSQKT VDEVWRDMMC  120
FGGGGASAAP AAAEPPPPAH RQQTLGEITL EEFLVRAGVV REDMSGPPVP PAPTPTAPAV  180
PPPPPPQQQT PMLFGQSNVF PPMVPPLSLG NGLVSGAVGN GGGGAASLVS PVRPVSSNGF  240
GKMEGGDLSS LSPSPVPYVF NGGLRGRKAP GIEKVVERRQ RRMIKNRESA ARSRQRKQAY  300
MMELEAEVAK LKELNDELQK KQDEMLEQQK NEVLERMSRQ VGPTAKRICL RRTLTGPW
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates abscisic acid (ABA) signaling (PubMed:18931143, PubMed:19947981, PubMed:27424498, PubMed:27325665). Can regulate the expression of a wide spectrum of stress-related genes in response to abiotic stresses through an ABA-dependent regulation pathway. Confers ABA-dependent drought and salinity tolerance (PubMed:18931143, PubMed:27325665). Binds specifically to the ABA-responsive elements (ABRE) in the promoter of target genes to mediate stress-responsive ABA signaling (PubMed:27325665, PubMed:27424498). {ECO:0000269|PubMed:18931143, ECO:0000269|PubMed:19947981, ECO:0000269|PubMed:27325665, ECO:0000269|PubMed:27424498}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) (PubMed:18315698, PubMed:18931143). Induced by drought, salt and osmotic stresses (PubMed:18931143). {ECO:0000269|PubMed:18315698, ECO:0000269|PubMed:18931143}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0720620.0AK072062.1 Oryza sativa Japonica Group cDNA clone:J013109E06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625853.10.0bZIP transcription factor 23
SwissprotQ6Z3120.0BZP23_ORYSJ; bZIP transcription factor 23
TrEMBLA0A0E0CRX40.0A0A0E0CRX4_9ORYZ; Uncharacterized protein
STRINGOMERI02G31310.10.0(Oryza meridionalis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.24e-40ABRE binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Xiang Y,Tang N,Du H,Ye H,Xiong L
    Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.
    Plant Physiol., 2008. 148(4): p. 1938-52
    [PMID:18931143]
  3. Shen J,Xie K,Xiong L
    Global expression profiling of rice microRNAs by one-tube stem-loop reverse transcription quantitative PCR revealed important roles of microRNAs in abiotic stress responses.
    Mol. Genet. Genomics, 2010. 284(6): p. 477-88
    [PMID:20941508]
  4. Luo C,Guo C,Wang W,Wang L,Chen L
    Overexpression of a new stress-repressive gene OsDSR2 encoding a protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice.
    Plant Cell Rep., 2014. 33(2): p. 323-36
    [PMID:24247850]
  5. Sakuraba Y, et al.
    Rice ONAC106 Inhibits Leaf Senescence and Increases Salt Tolerance and Tiller Angle.
    Plant Cell Physiol., 2015. 56(12): p. 2325-39
    [PMID:26443376]
  6. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]
  7. Dey A,Samanta MK,Gayen S,Sen SK,Maiti MK
    Enhanced Gene Expression Rather than Natural Polymorphism in Coding Sequence of the OsbZIP23 Determines Drought Tolerance and Yield Improvement in Rice Genotypes.
    PLoS ONE, 2016. 11(3): p. e0150763
    [PMID:26959651]
  8. Zong W, et al.
    Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.
    Plant Physiol., 2016. 171(4): p. 2810-25
    [PMID:27325665]
  9. Dey A,Samanta MK,Gayen S,Maiti MK
    The sucrose non-fermenting 1-related kinase 2 gene SAPK9 improves drought tolerance and grain yield in rice by modulating cellular osmotic potential, stomatal closure and stress-responsive gene expression.
    BMC Plant Biol., 2016. 16(1): p. 158
    [PMID:27411911]
  10. Gui J, et al.
    OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.
    Dev. Cell, 2016. 38(2): p. 201-13
    [PMID:27424498]