PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G27920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 382aa    MW: 40785.4 Da    PI: 7.484
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G27920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.2e-32200253255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OMERI02G27920.1 200 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 253
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15198254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28198253IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-23200254IPR006447Myb domain, plants
PfamPF002492.0E-7201252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPPAT KSMDLGFWKR ALETSTTTTA ASAATAAAST APSVATSSPP  60
VASGGVGVGA GGFYQQAAVA PAANGHGHGH GHHHHHQQHH QLGGALQFLH RTQPIPPQDA  120
AGGGGGGLQD LAFARPIRGI PVYNTSRPLP FLQSHHLQHH QHCYADAIGV EPGAGPRSPS  180
KQTAALRLAA APAKRGARAP RMRWTTSLHA RFVHAVELLG GHERATPKSV LELMDVKDLT  240
LAHVKSHLQM YRTIKTTDHK QPAPPYGQTK TIIEIPDDNL FDINNSTSGS ESSVQQQSKN  300
LDGNEQGSNM CALWSNNSSS RGAWFHDKSR DATPGDIKSF EDVQSQSPED DDASDLNSPP  360
FQIPETTVSA MKPNLDFTLG RM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0058590.0AP005859.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1053A04.
GenBankAP0058680.0AP005868.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0666E12.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623606.10.0probable transcription factor KAN2 isoform X1
TrEMBLA0A0E0CQ550.0A0A0E0CQ55_9ORYZ; Uncharacterized protein
STRINGOMERI02G27160.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.12e-35G2-like family protein