PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G27200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 622aa    MW: 64628.1 Da    PI: 9.1362
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G27200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.45.5e-932586222374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A av++g++++a +lL+ l+ +a+p+gd+ qRl+a+++ AL++r+           p+++ ++  s e+ aa +l+++vsP++ ++ 
  OMERI02G27200.1 258 RQLLSEAAAAVADGNHTAAASLLSALKLTANPRGDAEQRLVAMMVAALSSRVGT--------GPSQHLADLYSGEHRAACQLLQDVSPCFGLAL 343
                      689*************************************************98........5666666666899999**************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakr 185
                        aN aIl+av+g++++H +Dfd+s  +Q +aL++aLa+R+ ++ sl++T+v++p+s      +++l +t erL+k+A++ g++f+f++ v+ r
  OMERI02G27200.1 344 HGANLAILDAVAGHRAIHLVDFDVSA-AQHVALIKALADRRVPATSLKVTVVADPTSPftpaMTQSLAATCERLKKLAQQAGIDFRFRA-VSCR 435
                      ************************85.8**************************9988899999*************************.7889 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       +++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l P+vv++veqe+++n+++ ++rf++a  ++ a+++sl+a+l+r+s
  OMERI02G27200.1 436 AAEIEASKLGCEPGEALAVNLAFTLSRVPDESVSPANPRDELLRRVRALGPRVVTLVEQELNTNTAPMAARFSDASAHFGAVLESLDATLGRDS 529
                      ********************************************************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       +r+  E++ l+ ++ n+v  eg +r+er+e ++kWr+r+++aGF++v+++e++   +++ l       + v+ ++g l  gW++r ++++SaW
  OMERI02G27200.1 530 ADRARAEAA-LASKVANAVGREGPDRVERCEVFGKWRARFGMAGFRAVAIGEDIGGRVRARLGPAL-PAFDVKLDNGRLGVGWMGRVVTVASAW 621
                      ********9.9***************************************************9998.66************************* PP

             GRAS 374 r 374
                      r
  OMERI02G27200.1 622 R 622
                      8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.126231603IPR005202Transcription factor GRAS
PfamPF035141.9E-90258622IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MDPAGAPWCD PRRGYGGYGV GSAALQAAVR QQSQQPRSDG AGGAAVTGGV LKRSLGEMER  60
WQQQRQVAAQ QAMYLRSVRQ RMDIGAVLGG AASSPAYGIS GFSSGFGGIS PQQPSSTMSS  120
LTTASRTVMP GMQQQQLLQR RMMAVPAAQN QAVARAPSAR PATATELVLL QELEKQLLGD  180
DDEADAAGSG CGSGITSSDW GETIQRLNSV TAASSPSLPL PTAVNSTALL ARSPTNSSSS  240
TASSSASSSP PISAASSRQL LSEAAAAVAD GNHTAAASLL SALKLTANPR GDAEQRLVAM  300
MVAALSSRVG TGPSQHLADL YSGEHRAACQ LLQDVSPCFG LALHGANLAI LDAVAGHRAI  360
HLVDFDVSAA QHVALIKALA DRRVPATSLK VTVVADPTSP FTPAMTQSLA ATCERLKKLA  420
QQAGIDFRFR AVSCRAAEIE ASKLGCEPGE ALAVNLAFTL SRVPDESVSP ANPRDELLRR  480
VRALGPRVVT LVEQELNTNT APMAARFSDA SAHFGAVLES LDATLGRDSA DRARAEAALA  540
SKVANAVGRE GPDRVERCEV FGKWRARFGM AGFRAVAIGE DIGGRVRARL GPALPAFDVK  600
LDNGRLGVGW MGRVVTVASA WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-372536221375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2244260.0AY224426.1 Oryza sativa (japonica cultivar-group) isolate 20145 scarecrow transcriptional regulator-like protein mRNA, complete cds.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041780.0AP004178.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1123_G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0CPU60.0A0A0E0CPU6_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g45760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.14e-89SCARECROW-like 8