PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G21390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 324aa    MW: 35825.4 Da    PI: 7.7217
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G21390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.41.4e-53371631128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +k+++    +++++ e+d++k+ePwdLp++++ +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkd+e+++
  OMERI02G21390.1  37 LPPGFRFHPTDEELITHYLLRKAADPAGFAARAVGEADLNKCEPWDLPSRATMGEKEWYFFCVKDRKYPTGLRTNRATESGYWKATGKDREIFR 130
                      79*********************9999666689***************988899**************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++lvg+kktLvfy+grap+g kt Wvmheyr+
  OMERI02G21390.1 131 -GKALVGMKKTLVFYTGRAPRGGKTGWVMHEYRI 163
                      .99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6424185IPR003441NAC domain
PROSITE profilePS5100559.80137185IPR003441NAC domain
PfamPF023652.2E-2938163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MRLARQQQQQ QVVVAATMEH DVHHHRQMMQ QQQEMDLPPG FRFHPTDEEL ITHYLLRKAA  60
DPAGFAARAV GEADLNKCEP WDLPSRATMG EKEWYFFCVK DRKYPTGLRT NRATESGYWK  120
ATGKDREIFR GKALVGMKKT LVFYTGRAPR GGKTGWVMHE YRIHGKHAAS NSKDQEWVLC  180
RVFKKSLELA PAAAAAAGRR GAGAGTDVGP SSMPMADDVG QFLDTPYLLP AADPADHLAM  240
SSASPFLEAL QMQYVQDAAA AGGAGMVHEL LMGGGWYCNK GERERLSGAS QDTGLTSSEV  300
NPGEISSSSR QQRMDHHDAS LWAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-563418514165NO APICAL MERISTEM PROTEIN
1ut4_B8e-563418514165NO APICAL MERISTEM PROTEIN
1ut7_A8e-563418514165NO APICAL MERISTEM PROTEIN
1ut7_B8e-563418514165NO APICAL MERISTEM PROTEIN
3swm_A9e-563418517168NAC domain-containing protein 19
3swm_B9e-563418517168NAC domain-containing protein 19
3swm_C9e-563418517168NAC domain-containing protein 19
3swm_D9e-563418517168NAC domain-containing protein 19
3swp_A9e-563418517168NAC domain-containing protein 19
3swp_B9e-563418517168NAC domain-containing protein 19
3swp_C9e-563418517168NAC domain-containing protein 19
3swp_D9e-563418517168NAC domain-containing protein 19
4dul_A8e-563418514165NAC domain-containing protein 19
4dul_B8e-563418514165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8347650.0CT834765.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA021O03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623390.10.0PREDICTED: NAC domain-containing protein 92 isoform X2
SwissprotQ9FLJ21e-89NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0E0CMF90.0A0A0E0CMF9_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g36880.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.15e-85NAC domain containing protein 100