PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G19400.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 326aa    MW: 35287.8 Da    PI: 7.7028
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G19400.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.98.1e-071902391463
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R + +rsR RK+++i+ Le+ v++L++   +L+ ++ +l ++  +l +e+
  OMERI02G19400.2 190 RRSGQRSRVRKLQYIADLERTVDSLQNIGADLAVRVASLFQLRNALSMEN 239
                      67889***************************999999999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147035.14E-16189233No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-5190251No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSLFTQSC RFPSEDPFVG EPPCWLDDLL ADSGKSHTLP  60
PLRRACSDSD AILDVLTTFQ SPIYPIDEGD LQPVGEAGES FNAAAEGGGS GAGIEGSCVY  120
GPNSPRQKTR LTSSESSMVN AVLENVPSNP LQYLMIDATS GVNCNVGAAN GTGDIGDTVC  180
HADQEKSLKR RSGQRSRVRK LQYIADLERT VDSLQNIGAD LAVRVASLFQ LRNALSMENK  240
QLRRQITGLQ QAKLIKDGQT QMLKKETERL KQISVRHRRS RSVTSCFEAN SFGGGDPSAI  300
NWQMLDMSKL SLNGGAVVPP RGGYGM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195RRSGQRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0636440.0AK063644.1 Oryza sativa Japonica Group cDNA clone:001-118-H05, full insert sequence.
GenBankHQ3248080.0HQ324808.1 Oryza sativa Japonica Group clone KCS608G03 b-zip protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623493.10.0basic leucine zipper 34
TrEMBLA0A0E0CLM60.0A0A0E0CLM6_9ORYZ; Uncharacterized protein
STRINGOMERI02G18670.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-18bZIP family protein