PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G11410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 272aa    MW: 28359 Da    PI: 6.4055
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G11410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.7e-11145191551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++  
  OMERI02G11410.1 145 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQMEVSALSPRVAF 191
                      899**********************************9999877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-13141205IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.611143199IPR004827Basic-leucine zipper domain
PfamPF001707.3E-10145195IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-13145199No hitNo description
SuperFamilySSF579591.2E-11145199No hitNo description
CDDcd147031.81E-21146196No hitNo description
PROSITE patternPS000360148163IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAQLPPRAPS AAAAGQEWSA MAAAGEFLGF AAARRGAHRR SASDSAAFLM EAAVPMDDVI  60
VGGGGGGGEF DRLDDEQLMS MFSDVEAPAP AAVSDGGGER GPAGEAHLMD MGDGDDGMGA  120
TSPAGAGAMA AAAAAAAADG IADPKRVKRI LANRQSAQRS RVRKLQYISE LERSVTTLQM  180
EVSALSPRVA FLDHQRSLLT VGNSHLKQRI AALAQDKIFK DAHQEALKKE IERLRQVYHQ  240
QQIKATGGAD IATAASMQAK HELLACEGAA MR
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By white light. {ECO:0000269|PubMed:18065552}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0056140.0AP005614.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0090H18.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622790.11e-136basic leucine zipper 19
SwissprotQ6K3R91e-137BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A0E0CII70.0A0A0E0CII7_9ORYZ; Uncharacterized protein
STRINGOMERI02G11280.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-57bZIP family protein