PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G07160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 251aa    MW: 26426.7 Da    PI: 10.0086
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G07160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.31.4e-071501922163
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R RKk+++ e ++ v +L  eN++L++e+ +l+  +a+l +e+
  OMERI02G07160.1 150 RPRKKMRLPEVQQLVRSLAVENDSLREEMRTLQRACAALSKEN 192
                      89*************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.9E-4150189No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDCAGDDDAV AADIICSLRG ADLAGWTPPW WCSSSSKGAA REELIWPPVT RGKRSRRRSP  60
SAVAAAAGKK GRWARASPAS PLDYSGGSRS GSGSGSGSGS AASTSGGEDG AFCSPPGHRP  120
APATTKVGAM GRQQQLPFLA PSPLRPAGQR PRKKMRLPEV QQLVRSLAVE NDSLREEMRT  180
LQRACAALSK ENDKLEIRLE ISSSRNKPMI TEDLKGKQQI DQQSATQSIG GGFALPDLNI  240
PVQDVADGSV H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149155RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1076300.0AK107630.1 Oryza sativa Japonica Group cDNA clone:002-131-E03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626239.11e-151uncharacterized protein LOC4328519 isoform X1
TrEMBLA0A0E0CGS01e-179A0A0E0CGS0_9ORYZ; Uncharacterized protein
STRINGOMERI02G07100.11e-180(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951