PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G07120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 627aa    MW: 68656.4 Da    PI: 6.7009
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G07120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.3e-28211264155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++Fv av+qL G+ekA+Pk+il+lm+v+ +t+e+v+SHLQkYRl
  OMERI02G07120.1 211 KPRVVWSVELHRKFVAAVNQL-GIEKAVPKKILDLMNVENITRENVASHLQKYRL 264
                      79*******************.********************************8 PP

2Response_reg78.91.8e-26291371109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ +++l+++l + +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+ge +++ + +  
  OMERI02G07120.1  29 VLAVDDDPTCLKILENLLLRCQY-HVTTTGQAATALKLLRENKdqFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGETQTVMKGITH 120
                      799********************.***************888889*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+  e+l++
  OMERI02G07120.1 121 GACDYLLKPVRLEQLRT 137
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.5E-1981627IPR017053Response regulator B-type, plant
SuperFamilySSF521722.56E-3526148IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.9E-4226166No hitNo description
SMARTSM004481.8E-3227139IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.42528143IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2329138IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.21E-2730143No hitNo description
SuperFamilySSF466891.24E-19208268IPR009057Homeodomain-like
PROSITE profilePS5129410.912208267IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-29209269IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-24211264IPR006447Myb domain, plants
PfamPF002493.8E-6213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MTVEERQGRV GGHGVSGGGR DQFPVGMRVL AVDDDPTCLK ILENLLLRCQ YHVTTTGQAA  60
TALKLLRENK DQFDLVISDV HMPDMDGFKL LELVGLEMDL PVIMLSANGE TQTVMKGITH  120
GACDYLLKPV RLEQLRTIWQ HVIRRKNCDA KNRGNDDDAG QKAQGMNNEG ESIGANRNKR  180
QSRKSRDENG DDGDDSDENS NENGDSSTQK KPRVVWSVEL HRKFVAAVNQ LGIEKAVPKK  240
ILDLMNVENI TRENVASHLQ KYRLYLKRLS TDASRQANLA AAFGGRNPAY INMNSFGNYN  300
AYGRYRTVPT AGHTQANNIL TRMNSPSAFG VHGLLHSQQI QLGHPQNNLS TSLNDLGGLN  360
NGNMIRGAQM STILTGPSGN SFPSISNGAP LATANRSLQP LESSNQSNQQ HLSRVHSSSA  420
GPFSTLVGES PQFPDLGRTT NTWQTAVPSN IQDRGHNDSM SQATLHMNGP KIEPVSSFTS  480
SNQIPLLGNE MQGQVASLAS NVPIAFNQEA SPFNYRSSTN SRDMLNNSHI FSNSSINTSL  540
PNLSLDNPAV PRQTLDRGNT GIVSPMQDGR IHHQAVSNQL NYNDDLMRTT GLQRGLSGGL  600
DDIVVDMFRP DREDDGVPYI DGDWELV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-26207270164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1005300.0AK100530.1 Oryza sativa Japonica Group cDNA clone:J023101H04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626716.10.0PREDICTED: two-component response regulator ORR24
SwissprotQ6H8050.0ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A0E0CGR10.0A0A0E0CGR1_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g08500.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-112response regulator 12