PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G06800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 521aa    MW: 53395.9 Da    PI: 6.7695
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G06800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.8e-07213258342
         zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                       ++C+ +e  ++   C+ +   lC+ C   +H        H++vp+
  OMERI02G06800.1 213 VWVCEVCEVAPAAVTCKADAAVLCAACDADIHDAnplarrHERVPV 258
                      689*****************************44788888999986 PP

2CCT68.81.5e-23447490144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      R+a+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k+a
  OMERI02G06800.1 447 RAARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRA 490
                      99****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0411158IPR000315B-box-type zinc finger
SMARTSM003361.1170210IPR000315B-box-type zinc finger
SMARTSM003362.9E-13211258IPR000315B-box-type zinc finger
PROSITE profilePS5011910.594211258IPR000315B-box-type zinc finger
CDDcd000211.14E-6214258No hitNo description
PfamPF062031.7E-17447489IPR010402CCT domain
PROSITE profilePS5101716.807447489IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MELGLGRYWG VGGRRCGACA VAPAAVHCRT CDGGGGGGYL CAGCDAEHGR AGHERVWVCE  60
PIGSSAAAPP DALLFGGEND AAAAAVDLTT AAGGGVGGKE VKLDFLFADY FMDPYLGGSP  120
ELARFPHADS VVPNHNGSAV SSPPHHCRRA APRHATPSRA MMELRKYWGV GGRRCGACEA  180
SPAAVHCRGC GGVYLCTACD ARPGHARAAH ERVWVCEVCE VAPAAVTCKA DAAVLCAACD  240
ADIHDANPLA RRHERVPVQP IGSSAAAPPD ALLFGGENDA AAAAVDLTTA AGGGVGGKEV  300
KLDFLFADYF MDPYLGGSPE LARFPHADSV VPNHNGSAGP AMELGFASGG GGATAAAVKP  360
SYSSYTAASL GNSGSSSEVG LVPDAICGGG GIIELDFAQS KAAFLPYAST PSHSMSSSMD  420
MGVAAPEMSD GAAEAGRAYA AAAAEGRAAR LMRYREKRKN RRFEKTIRYA SRKAYAETRP  480
RVKGRFAKRA DDHDDADAAA AAAPPPHVML DFAGYGVVPT F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096300.0AK109630.1 Oryza sativa Japonica Group cDNA clone:002-138-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623284.11e-156zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0CGL20.0A0A0E0CGL2_9ORYZ; Uncharacterized protein
STRINGOMERI02G06740.11e-168(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-18CONSTANS-like 4