PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G06020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 231aa    MW: 24902.8 Da    PI: 10.1561
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G06020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-312578255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     pr+rW +eLH+rFv+av++LGGs++AtPk+i++lm+ kgLtl+hvkSHLQ+YR 
  OMERI02G06020.1 25 PRMRWPEELHRRFVDAVRRLGGSHEATPKRIMQLMDAKGLTLSHVKSHLQMYRN 78
                     9****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-292179IPR009057Homeodomain-like
SuperFamilySSF466896.63E-152379IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-232578IPR006447Myb domain, plants
PfamPF002495.9E-82677IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGGGAGSSSS SSSVVVRRYN RSEAPRMRWP EELHRRFVDA VRRLGGSHEA TPKRIMQLMD  60
AKGLTLSHVK SHLQMYRNSN NSSNVNRRRP VSPRIDWTTQ QDEQQRRQMS SSFSFLATRM  120
VLAAGIGSHG RHQRPHRRQG LPAGDDDGCE LTLSIGGGAG EESSDGGGSS ISDDDELLIQ  180
PAPNIINGST RPPPAANAGA ATKKEAMMSG QTAAAAINLE LTISSPCCWL I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-162679356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-162679356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-162679356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-162679356Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1082111e-168AK108211.1 Oryza sativa Japonica Group cDNA clone:002-140-D10, full insert sequence.
GenBankCT8314001e-168CT831400.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA117D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624627.14e-97transcription factor HHO5
TrEMBLA0A0E0CG871e-169A0A0E0CG87_9ORYZ; Uncharacterized protein
STRINGOMERI02G05980.11e-169(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1991088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.17e-22G2-like family protein