PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G03860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 465aa    MW: 51728.8 Da    PI: 5.5123
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G03860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-33263317155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWtpeLHerFv+av++L G+ekAtPk +l+lmkv+gLt++h+kSHLQkYRl
  OMERI02G03860.1 263 KPRLRWTPELHERFVDAVNKLEGPEKATPKGVLKLMKVEGLTIYHIKSHLQKYRL 317
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.818260320IPR017930Myb domain
SuperFamilySSF466891.97E-17261317IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-31262318IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-25263318IPR006447Myb domain, plants
PfamPF002494.0E-9265316IPR001005SANT/Myb domain
PfamPF143796.2E-22351397IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MSTQSVIAVK QFSGPDKMAQ AYTVPQPSAH MLSNANYDLC GSTNSTSLSC AIQSSNIKTE  60
SISSYSLPKI LPFSTDSNGE SSLSRMSQAE FSDPILSSSS TFCTSLYTLS PMNSGSCRKT  120
GDLPFLPQPP KCEQQQNSAG QSSSSLMLLD ADLRNSGHVD DEHTDDLKDF LNLSSDCSFH  180
GKCSAMAYNE QMEFQFLSEQ LGIAISNNEE SPRLDDIYDR PPQLLSLPVS SCSDQEDLQD  240
ARSPAKVQLS SSRSSSGTAS CNKPRLRWTP ELHERFVDAV NKLEGPEKAT PKGVLKLMKV  300
EGLTIYHIKS HLQKYRLAKY LPETKEDKKQ EEKKAKSVAN GNDHAKKKSA QMAEALRMQM  360
EVQKQLHEQL EVQRQLQLRI EEHARYLQKI LEEQQKARES ISSMTSTTEG ESPEFASMEK  420
TEDKAETSSE PLSKCRITDT DAECHSKVDN KKTKPQADLE MVHDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-26263320259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated under Pi starvation conditions. {ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0657040.0AK065704.1 Oryza sativa Japonica Group cDNA clone:J013037C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627390.10.0protein PHOSPHATE STARVATION RESPONSE 3
RefseqXP_015627391.10.0protein PHOSPHATE STARVATION RESPONSE 3
SwissprotQ6YXZ40.0PHR3_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 3
TrEMBLA0A0E0CFB30.0A0A0E0CFB3_9ORYZ; Uncharacterized protein
STRINGOMERI02G03900.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.23e-65G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]