PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G02860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 499aa    MW: 53683.9 Da    PI: 5.7012
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G02860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.22e-09381406126
                      XXXXCHHHCHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKka 26 
                      e+elk+++rkq+NRe+ArrsR+RK+ 
  OMERI02G02860.1 381 ERELKKQKRKQSNRESARRSRLRKQN 406
                      89**********************96 PP

2bZIP_130.21e-094194582463
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  24 KkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      ++ae+eeL  ++++L aeN++L+ ele++kke+++l s++
  OMERI02G02860.1 419 FQAECEELSVRADNLRAENSSLRAELERIKKEYEALLSHN 458
                      59**********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077777.8E-17165243IPR012900G-box binding protein, multifunctional mosaic region
PfamPF165968.6E-20260363No hitNo description
Gene3DG3DSA:1.20.5.1704.1E-13379455No hitNo description
PfamPF001701.3E-7381406IPR004827Basic-leucine zipper domain
SMARTSM003381.1E-11381460IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.87E-5384442No hitNo description
CDDcd147026.27E-20386451No hitNo description
PROSITE patternPS000360388403IPR004827Basic-leucine zipper domain
PfamPF001707.5E-7420458IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MGFFRRIAGM FGISRDDADH HPHHHHDGAA GDSAEVPQDK VAAAAAAAAT AGNVQRRGFS  60
VQVPVPVERP GPGPVLVPCP QGEGGVQGFR WYTRKLRIDE DGDVADEFLD EVVPEILINN  120
DATPAGRYQV KYNTKSAALA MRKQISVIDG DICHSLEYQG RLRWMGINDP GTPSKATKAS  180
EPEQSPATTS GTSAPVYPEW PGFQAYSAIP PHGFFPPPVA ASPQAHPYMW GAQGVHPFNH  240
YPMPANGNVE TAGTAPGASE INGKNELGRT SGPSANGTTS HSESGSESES EGSDANSQND  300
SHSKENDVKE DGSSQNGMSH TALNQNMSMA PTQTGVVIGG VAPTTNLNIG MDYWGAAGSS  360
PVPAMHGKAP SGSVRGEQWD ERELKKQKRK QSNRESARRS RLRKQNIKDS LIEAPKYLFQ  420
AECEELSVRA DNLRAENSSL RAELERIKKE YEALLSHNAS LKEKLEGNSD SIPDMNEQND  480
TNGSHQKQQD SDAQPNDAP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1397403RRSRLRK
2397404RRSRLRKQ
Functional Description ? help Back to Top
Source Description
UniProtBinds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119010.0AK111901.1 Oryza sativa Japonica Group cDNA clone:J023076M20, full insert sequence.
GenBankAK1120090.0AK112009.1 Oryza sativa Japonica Group cDNA clone:006-209-B12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626323.10.0transcription factor HBP-1a
RefseqXP_015626324.10.0transcription factor HBP-1a
SwissprotP239221e-134HBP1A_WHEAT; Transcription factor HBP-1a
TrEMBLA0A0E0CEV70.0A0A0E0CEV7_9ORYZ; Uncharacterized protein
STRINGOMERI02G02910.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21473796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32150.14e-53basic region/leucine zipper transcription factor 68
Publications ? help Back to Top
  1. Tabata T,Nakayama T,Mikami K,Iwabuchi M
    HBP-1a and HBP-1b: leucine zipper-type transcription factors of wheat.
    EMBO J., 1991. 10(6): p. 1459-67
    [PMID:2026143]
  2. Tabata T, et al.
    A protein that binds to a cis-acting element of wheat histone genes has a leucine zipper motif.
    Science, 1989. 245(4921): p. 965-7
    [PMID:2772648]
  3. Mikami K, et al.
    Developmental and tissue-specific regulation of the gene for the wheat basic/leucine zipper protein HBP-1a(17) in transgenic Arabidopsis plants.
    Mol. Gen. Genet., 1995. 248(5): p. 573-82
    [PMID:7476857]
  4. Nakayama T,Okanami M,Meshi T,Iwabuchi M
    Dissection of the wheat transcription factor HBP-1a(17) reveals a modular structure for the activation domain.
    Mol. Gen. Genet., 1997. 253(5): p. 553-61
    [PMID:9065688]
  5. Okanami M,Meshi T,Tamai H,Iwabuchi M
    HALF-1, a bZIP-type protein, interacting with the wheat transcription factor HBP-1a contains a novel transcriptional activation domain.
    Genes Cells, 1996. 1(1): p. 87-99
    [PMID:9078369]