PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G42240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 240aa    MW: 25778.5 Da    PI: 6.9768
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G42240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.39.6e-30120172255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +rl+Wtp+LH+rFve+v++L G ++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  OMERI01G42240.1 120 ARLVWTPQLHKRFVEVVAHL-GMKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 172
                      79******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-30116177IPR009057Homeodomain-like
PROSITE profilePS5129411.54116175IPR017930Myb domain
SuperFamilySSF466893.94E-19117176IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23120172IPR006447Myb domain, plants
PfamPF002492.2E-9122171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGEEAPEEYE LGGGEDERVM EWEAGLPGAD ELTPLSQPLV PAGLAAAFRI PPEPGRTLLD  60
VHRASAATVS RLRRASSSSS SSFPAFASKG AGADEAESGG GADGGNGNTN NTNSSSSKRA  120
RLVWTPQLHK RFVEVVAHLG MKNAVPKTIM QLMNVEGLTR ENVASHLQKY RLYVKRMQGL  180
SNEGPSPSDH IFASTPVPHA SLHDQVPSPY PPHPHHHSSY NNAAYAATVS SYHHYHHANH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-32119175157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2065780.0AB206578.1 Oryza sativa Japonica Group OsPCL1 gene for putative transcription factor, complete cds.
GenBankAP0032770.0AP003277.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0518C01.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY5812560.0AY581256.1 Oryza sativa (japonica cultivar-group) induced protein MgI1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878289.11e-122transcription factor PCL1
SwissprotQ94DH31e-123PCL1_ORYSJ; Transcription factor PCL1
TrEMBLA0A0E0CDI91e-175A0A0E0CDI9_9ORYZ; Uncharacterized protein
STRINGOMERI01G41790.11e-175(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-46G2-like family protein