PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G39870.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 475aa    MW: 51063.1 Da    PI: 10.2058
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G39870.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.51.2e-34683178
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78
                     +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasnv+k+l++lp +++ da+sslvyeA+ r+rdPvyG+vg
  OMERI01G39870.5  6 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNVSKMLQELPAQQQGDAVSSLVYEANDRMRDPVYGCVG 83
                     7***************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.7245106IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-35683IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009913Biological Processepidermal cell differentiation
GO:0010090Biological Processtrichome morphogenesis
GO:0030307Biological Processpositive regulation of cell growth
GO:0042023Biological ProcessDNA endoreduplication
GO:0048364Biological Processroot development
GO:0048367Biological Processshoot system development
GO:0051276Biological Processchromosome organization
GO:0005634Cellular Componentnucleus
GO:0009330Cellular ComponentDNA topoisomerase complex (ATP-hydrolyzing)
GO:0003690Molecular Functiondouble-stranded DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MGSGSPCASC KLLRRRCTKD CIFAPFFPAD DPHKFAIVHK VFGASNVSKM LQELPAQQQG  60
DAVSSLVYEA NDRMRDPVYG CVGPGPSPSC RTRCHSCRCS SPSHRARSSA SRCSTAMATR  120
TRRIRTTTRT LAPARRLPGS RLPSRLDSVS ASAPPPRLPS LALLPQSCWL SPSAGDRSHR  180
PAAWALGTGL PGKGRQGGVE ATPPFCRRRV PSAPPHSPPL PLLDDRRPRP RPTSSLAPSL  240
ALLLPSKVQR TTQRKILGYA TGCHLPSPPV LRSAGPCSGF PSIVSSEGVL REGGAGMGEE  300
EDPDWLRAFQ PPTTSTALIE CDGDSIDLSG DVGAVGRIVI SNSPNGNQDL LLDLKGTIYK  360
STIVPSRTFC VIESIMNDFI QLEPQSNLFE AETMMEGTLD GFTFDSDEEG DKLPEPHASQ  420
NDQNNEDGDQ PKAKTKRKAE KPAGKGQKKA KVAGKATKKG TRKTQTTKRT KKAKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126091e-168CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0CCL90.0A0A0E0CCL9_9ORYZ; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-45LBD family protein