PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G39870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 575aa    MW: 62217 Da    PI: 8.2943
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G39870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.73e-366101197
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasnv+k+l++lp +++ da+sslvyeA+ r+rdPvyG+ + +++lq ql+ ++ e+
  OMERI01G39870.1   6 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNVSKMLQELPAQQQGDAVSSLVYEANDRMRDPVYGCNQ-VSQLQMQLAVAQGEI 98 
                      7***************************************************************************76.688999999988887 PP

           DUF260  95 all 97 
                        +
  OMERI01G39870.1  99 LCI 101
                      655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.9985105IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-36698IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009913Biological Processepidermal cell differentiation
GO:0010090Biological Processtrichome morphogenesis
GO:0030307Biological Processpositive regulation of cell growth
GO:0042023Biological ProcessDNA endoreduplication
GO:0048364Biological Processroot development
GO:0048367Biological Processshoot system development
GO:0051276Biological Processchromosome organization
GO:0005634Cellular Componentnucleus
GO:0009330Cellular ComponentDNA topoisomerase complex (ATP-hydrolyzing)
GO:0003690Molecular Functiondouble-stranded DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MGSGSPCASC KLLRRRCTKD CIFAPFFPAD DPHKFAIVHK VFGASNVSKM LQELPAQQQG  60
DAVSSLVYEA NDRMRDPVYG CNQVSQLQMQ LAVAQGEILC IQMQHRDGNE NEENSCWLSP  120
SAGDRSHRPA AWALGTGLPG KGRQGGVEAT PPFCRRRVPS APPHSPPLPL LDDRRPRPRP  180
TSSLAPSLAL LLPSKVQRTT QRKILGYATG CHLPSPPVLR SAGPCSGFPS IVSSEGVLRE  240
GGAGMGEEED PDWLRAFQPP TTSTVMLSSD SYDSPENSPT RTTPSGEEQK GENKASSDHV  300
GDGDVAAPNK GKKATPTRRK TPTSQEDAFG KDEKPTMESN QDKPAKRSTP KKLVKLPSSS  360
NASKVTGPKA GPDQIDDTLE HREEGVAEVD MQDKLTEHSV SQRLPLIIPD KVQRSKALIE  420
CDGDSIDLSG DVGAVGRIVI SNSPNGNQDL LLDLKGTIYK STIVPSRTFC VIESIMNDFI  480
QLEPQSNLFE AETMMEGTLD GFTFDSDEEG DKLPEPHASQ NDQNNEDGDQ PKAKTKRKAE  540
KPAGKGQKKA KVAGKATKKG TRKTQTTKRT KKAKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2431990.0AK243199.1 Oryza sativa Japonica Group cDNA, clone: J100040F14, full insert sequence.
GenBankAK0593400.0AK059340.1 Oryza sativa Japonica Group cDNA clone:001-026-B04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625935.10.0PREDICTED: DNA-binding protein BIN4
TrEMBLA0A0E0CCL50.0A0A0E0CCL5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000185-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-56LBD family protein