PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G37950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 582aa    MW: 64799.4 Da    PI: 4.8449
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G37950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.78.4e-26192245155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+gLt+e+v+SHLQkYRl
  OMERI01G37950.1 192 KARVVWSVDLHQKFVNAVNQI-GFDKVGPKKILDLMNVPGLTRENVASHLQKYRL 245
                      68*******************.9*******************************8 PP

2Response_reg80.55.4e-27121201109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+vdD+p+ +++l+++l+k  y ev+++  ++ al++l+e++  +D+++ D++mp+mdG++ll++i  e  +lp+i+++  ge + + + ++ 
  OMERI01G37950.1  12 VLVVDDDPTWLKILEKMLRKCSY-EVTTCGLARVALDILRERKnkFDIVISDVNMPDMDGFKLLEHIGLEM-DLPVIMMSIDGETSRVMKGVQH 103
                      89*********************.***************877777**********************6654.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ ++el++
  OMERI01G37950.1 104 GACDYLLKPVRMKELRN 120
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.5E-1822575IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.0E-439146No hitNo description
SuperFamilySSF521725.98E-359133IPR011006CheY-like superfamily
SMARTSM004481.4E-3110122IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.71811126IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.5E-2412121IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.91E-2913125No hitNo description
SuperFamilySSF466893.49E-18189249IPR009057Homeodomain-like
PROSITE profilePS512949.161189248IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-28191250IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-22192245IPR006447Myb domain, plants
PfamPF002499.1E-8194244IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MDATAFPYGL RVLVVDDDPT WLKILEKMLR KCSYEVTTCG LARVALDILR ERKNKFDIVI  60
SDVNMPDMDG FKLLEHIGLE MDLPVIMMSI DGETSRVMKG VQHGACDYLL KPVRMKELRN  120
IWQHVYRKKM HEVKEIEGND SCDDLQILRN SFEGLDEKSL FMRSDSDTMR KRKDVDKDHA  180
DQESSDGNTV KKARVVWSVD LHQKFVNAVN QIGFDKVGPK KILDLMNVPG LTRENVASHL  240
QKYRLYLSRL QKQNEERILG AARQDFSHKG TSENLNLRSS FQEQPSNIAN GYPHASQNIQ  300
TQANMLDSQL EDTKSTVPLP VPDKRRTLAS DAADSQNVTS ASSLGGVLSF KSMPVNQDRK  360
PSETMILECQ AWTGGIPSKQ FMQYPKHNHE RCDLLGDYSC LPKPDLEHPV GPSNLYAPPP  420
LISMSCGMEG DARDFSDVKP AIMDCIKSLS PALTCTVDSV SVQLSDSVGT SIDGDLKSSG  480
VDGLPSIKDC CLDQTNSQGS LRPSQEPSII GSTELASLPE DLPSYPLHGV SLENIGLSSI  540
DLLNYSDAMI LSGLQSNWYD DLEFSSEMMD YPSIDECLFA SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-18191250463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0622500.0AK062250.1 Oryza sativa Japonica Group cDNA clone:001-047-G01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622017.10.0PREDICTED: two-component response regulator ORR26
SwissprotQ5N6V80.0ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A0E0CBS40.0A0A0E0CBS4_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g67770.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0348700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59003752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-113response regulator 11