PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G36460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 334aa    MW: 36699 Da    PI: 9.2391
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G36460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.22.3e-5191331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v s
  OMERI01G36460.1   9 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGS 101
                      79**************************99.88***************7666789*************************************99 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + v +kk Lvfy g+apkgekt+W+mheyrl
  OMERI01G36460.1 102 --PKPVAIKKALVFYAGKAPKGEKTNWIMHEYRL 133
                      ..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-586143IPR003441NAC domain
PROSITE profilePS5100557.0829195IPR003441NAC domain
PfamPF023652.7E-2610133IPR003441NAC domain
SuperFamilySSF1019412.88E-58183195IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSGGQDLQLP PGFRFHPTDE ELVMHYLCRR CAGLPIAVPI IAEIDLYKFD PWQLPRMALY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGSGYW KATGADKPVG SPKPVAIKKA LVFYAGKAPK  120
GEKTNWIMHE YRLADVDRSA RKKNSLRGRT YGVQLAQPRS NRLERETHSM PSPPRLIPFR  180
DQSLDDWVLC RIYNKKGGLE KPPAAAVAAA GMVSGGGGVE RKPMLGVNAA VSSPPEQKPV  240
VAGPAFPDLA AYYDRPSDSM PRLHADSSCS EQVLSPEFAC EVQSQPKISE WERTFATAGP  300
INPAASILDP AGCLGGGGSD PLLQDILMYW GKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-71620112174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469930.0EU846993.1 Oryza sativa Japonica Group clone KCS089G05 NAC6 protein mRNA, complete cds.
GenBankCT8417300.0CT841730.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C102I24, full insert sequence.
GenBankAB0281850.0AB028185.1 Oryza sativa mRNA for OsNAC6 protein, complete cds.
GenBankAK0683920.0AK068392.1 Oryza sativa Japonica Group cDNA clone:J013149P14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620920.10.0PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L30.0NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLA0A0E0CB680.0A0A0E0CB68_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000374-PA0.0(Oryza sativa Indica Group)
STRINGORGLA01G0334900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-116NAC family protein