PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G35430.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 267aa    MW: 28238.2 Da    PI: 6.8274
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G35430.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42.1e-15185237355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN ++ ke ee  ++
  OMERI01G35430.2 185 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAKMFKEQEEQHQK 237
                      689*************************************9998877655444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-8183247IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657185249IPR004827Basic-leucine zipper domain
PfamPF001703.4E-14185243IPR004827Basic-leucine zipper domain
CDDcd147071.79E-20187237No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-13188246No hitNo description
SuperFamilySSF579591.06E-10188235No hitNo description
PROSITE patternPS000360190205IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MMASRVMASS SPSHTASDLA RFAAGRGGGG SAGLGSMNVE EILRGIYADM PTPALPLVGG  60
DRPMSPLPAP DVAAAPRTAE EVWKEITGAG VAAAAGVVPP ATAAAAAPAV VAAAGAGTGA  120
EMTLEDFLAR EGAVKEDEAV VTDPSASVAE GQMVMGFLNG AEVAGGVTGG RSRKRHLMDP  180
MDRAAMQRQK RMIKNRESAA RSRERKQAYI AELESLVTQL EEENAKMFKE QEEQHQKRLK  240
ELKEMVVPVI IRKTSARDLR RTNSMEW
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679190.0AK067919.1 Oryza sativa Japonica Group cDNA clone:J013123H12, full insert sequence.
GenBankGQ9042380.0GQ904238.1 Oryza sativa Japonica Group ABA responsive element binding factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612904.11e-142bZIP transcription factor 12-like
SwissprotQ0JHF11e-143BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A0E0CAT70.0A0A0E0CAT7_9ORYZ; Uncharacterized protein
STRINGOMERI01G34900.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.14e-33bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]