PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G34110.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 281aa    MW: 29757.4 Da    PI: 8.1334
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G34110.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.14.8e-29128181155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r++WtpeLH+rFv+av++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
  OMERI01G34110.4 128 KARMVWTPELHHRFVQAVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 181
                      68*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.13E-19125185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-29127185IPR009057Homeodomain-like
PROSITE profilePS5129411.742127184IPR017930Myb domain
TIGRFAMsTIGR015577.2E-25128181IPR006447Myb domain, plants
PfamPF002499.1E-10130180IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0003729Molecular FunctionmRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSSARGGRPH DADAPLPSSS SSSSSSSSSS PSRRMVDTAA AAGDACGRVT EWETGLPAPG  60
EMTPVSHQLV PPALAAAFGI DLAAAGVLLP SPSVDSPVSH LFFPVDEDDD EDEEGEGEGG  120
NEGRCGKKAR MVWTPELHHR FVQAVAHLGE KGAVPKAIVR LMNVDGLTRE NVASHLQKYR  180
LYLKRTRVAA TPPPSPPPPP PPPPPLPPAM YVPCFAAKPP LDAANRSDSP PSRTSDATTK  240
QGDNAMRSRR RGAWAPAETN PQIRRRLRHA RAAVALTHPQ D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-25128184157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0666590.0AK066659.1 Oryza sativa Japonica Group cDNA clone:J013068K17, full insert sequence.
GenBankAP0032510.0AP003251.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0446B05.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878116.11e-120transcription factor PCL1-like
SwissprotQ94DH33e-36PCL1_ORYSJ; Transcription factor PCL1
TrEMBLA0A0E0CA810.0A0A0E0CA81_9ORYZ; Uncharacterized protein
STRINGORUFI01G40390.11e-120(Oryza rufipogon)
STRINGONIVA01G41940.11e-120(Oryza nivara)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.14e-28G2-like family protein