PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G31300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 368aa    MW: 39922 Da    PI: 5.3955
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G31300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.1e-11206257455
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +k+ rr ++NR +A +sR+RKk++++ Le+k+k Leae ++L   l+    e
  OMERI01G31300.1 206 SKKKRRQMRNRDSAMKSRERKKMYVKDLETKSKYLEAECRRLSYALQCCAAE 257
                      79*************************************9998777665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-6202267IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-12202266No hitNo description
PROSITE profilePS502179.737205247IPR004827Basic-leucine zipper domain
PfamPF001703.2E-10206263IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11207265No hitNo description
CDDcd147049.23E-14208259No hitNo description
PROSITE patternPS000360210225IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MTWHIQALPL AMPRHTPRGP HLLPSPKLSS PPPSSRSKIR ASPTSPPYIT TPTSSNRDKN  60
ISIAISMDVE FFADLDLDAL LASFSSSRSG VSGLFAPSPP HDAEAEAGSP ESVSSRRPSP  120
AREAALSEIE RFLMEEGPAA EEGVGAEDFF DALLVDGGEE GEEEEEEGKG SEAGGSTDRY  180
SGKENEVATP DAEKEDVEVD GDDPMSKKKR RQMRNRDSAM KSRERKKMYV KDLETKSKYL  240
EAECRRLSYA LQCCAAENMA LRQSLLKDRP VGAATAMQES AVLTETLPLV SLLWLVSIVC  300
LLLVPGLPNR NPVARSSAGR DLATVTGKKT SSEQQLEETL LLHGRRCKGS RARIKLDTGP  360
FRLAAAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206210KKKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070210.0AK107021.1 Oryza sativa Japonica Group cDNA clone:002-121-A01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641141.11e-160bZIP transcription factor 50
SwissprotQ69XV01e-161BZP50_ORYSJ; bZIP transcription factor 50
TrEMBLA0A0E0C9270.0A0A0E0C927_9ORYZ; Uncharacterized protein
STRINGOMERI01G30760.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.11e-11basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Wakasa Y, et al.
    Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.
    Plant J., 2011. 65(5): p. 675-89
    [PMID:21223397]
  2. Lu SJ, et al.
    Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.
    Mol Plant, 2012. 5(2): p. 504-14
    [PMID:22199238]