PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G30450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 709aa    MW: 78010 Da    PI: 7.5119
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G30450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox42.21.4e-1368122256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r+ +++t +q e+Le +F  + +p+  ++++L++ +gL  +qVk+WFqN+R++ k
  OMERI01G30450.1  68 RRLQRLTGKQSEVLEGFFSICGHPDDGQKRHLSETTGLGLDQVKFWFQNKRTQVK 122
                      455789*********************************************9877 PP

2START88.91.1e-282224372205
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EEEEEE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla...kaetle 83 
                      la  a+ +l+ +a++  ++W+ ++    e +n++ + q  + +++     +++ea ra+ +v m+   +v  l+d    + + ++   + ++++
  OMERI01G30450.1 222 LAKNAMHALIILAESHVALWFPVPgcsyEVLNKMAYDQAYPGDNSanaigFKTEATRAVSMVMMDYKSVVDFLMDPY-NYRTFFPeviSGAVTN 314
                      6788999999**************999988888888888866666888999****************6665555555.5555555444999999 PP

                      EECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
            START  84 vissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                      +i +        g++qlm+ e++++splvp R+ +f+Ry+  l++g  v+ dvS+d  +  +      ++++ pSg+li++   + +kvt +eh
  OMERI01G30450.1 315 RIYTWptsdgynGVIQLMTVEMMFPSPLVPaRKCTFLRYCNVLNEGLVVVIDVSLDDGSIFS------KCRKMPSGFLIQSIRPNSCKVTAIEH 402
                      9977777789*********************************************9988866......7************************* PP

                      EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      v  ++  +h+l+++ ++ gl++ga++wvat+ rq +
  OMERI01G30450.1 403 VLADDTGVHELYQPCMN-GLVFGARRWVATMARQSA 437
                      **************985.89***********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-1458118IPR009057Homeodomain-like
SuperFamilySSF466891.71E-1559126IPR009057Homeodomain-like
PROSITE profilePS5007114.25264124IPR001356Homeobox domain
SMARTSM003892.6E-1066128IPR001356Homeobox domain
CDDcd000862.12E-1267124No hitNo description
PfamPF000463.5E-1168122IPR001356Homeobox domain
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PROSITE profilePS5084818.551212441IPR002913START domain
CDDcd088753.52E-94216437No hitNo description
SMARTSM002341.7E-7221438IPR002913START domain
PfamPF018521.2E-21222437IPR002913START domain
SuperFamilySSF559612.93E-20271436No hitNo description
SuperFamilySSF559617.78E-9455664No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MEMNQQHNEG NESFVALMNG VAGDGTATLP NDGEQSMNIP TRELFAAIEA DSGLLPGNSS  60
NTNEKKKRRL QRLTGKQSEV LEGFFSICGH PDDGQKRHLS ETTGLGLDQV KFWFQNKRTQ  120
VKTMCWKEEN YKLSVENEIL RDENRRVKIA HCTAICLTCR NSSVQNQLAV EMERLMGQSE  180
WLQQEIARSN GTPPAANLAF QLNSSADYVF SGQHDQQMIA ELAKNAMHAL IILAESHVAL  240
WFPVPGCSYE VLNKMAYDQA YPGDNSANAI GFKTEATRAV SMVMMDYKSV VDFLMDPYNY  300
RTFFPEVISG AVTNRIYTWP TSDGYNGVIQ LMTVEMMFPS PLVPARKCTF LRYCNVLNEG  360
LVVVIDVSLD DGSIFSKCRK MPSGFLIQSI RPNSCKVTAI EHVLADDTGV HELYQPCMNG  420
LVFGARRWVA TMARQSARMR DVHHNKTAPQ VSTKGRKNLM KLADDLLASF AGGIAATGGG  480
TWTVVIGAGT EKDIRVAYRR TTEGSSSYNA ILSVSASLRL PLPMRKTFDL LRNLTHRCKW  540
DVLVHGSVVK EEVTIARGVG NDDTVTVLHC KRAGREDRGR TMILQNNGYD ASGSFMVYSQ  600
IDSELMNTMV LSPSDLPPGR GGPSLYPTGF SLLPDGQAAQ DSSGIALGEV GGTLMTMGFQ  660
IPVKLASGDR MYSRSAASAI RLMTDTIALV KKTLMNEHSG IYGVSPFNA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16468KKKRR
26469KKKRRL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3178820.0AF317882.1 Oryza sativa transcription factor 1 (TF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632244.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLA0A0E0C8P50.0A0A0E0C8P5_9ORYZ; Uncharacterized protein
STRINGORGLA01G0275300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.21e-104HD-ZIP family protein