PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G28810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 856aa    MW: 92782.1 Da    PI: 5.5337
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G28810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.39.4e-07192223132
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeeree 32 
                      r++ +++t+eq++++e+lF+++++p++++r++
  OMERI01G28810.1 192 RKNYHRHTAEQIRIMEALFKESPHPDERQRQQ 223
                      788999************************98 PP

2START1731.9e-543525782206
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                      la +a++elv + +++ep+Wv+ +    +++n+de+++ f ++++         s+ea+r++g+v  ++++lv  ++d+  +W+  ++    ka
  OMERI01G28810.1 352 LATRALDELVGMCSSGEPVWVRGVetgrDILNYDEYVRLFRRDHGgsgdqmagWSVEASRECGLVYLDTMQLVHAFMDVD-KWKDLFPtmisKA 444
                      78899*************************************999***********************************.99998888888** PP

                      EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
            START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                      +tle is+       g+lqlm+aelq l+p+vp R+ +f+Ry+++l a++w+ivdvS d+ +     ss vR+ + pSg+lie+  ng++k+tw
  OMERI01G28810.1 445 ATLEMISNReddgrdGVLQLMYAELQTLTPMVPtRELYFARYCKKLAAERWAIVDVSFDESETGVHASSAVRCWKNPSGCLIEEQNNGRCKMTW 538
                      *******99999***********************************************9999998**************************** PP

                      EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      veh+ ++  ++  l+r +  sg+a+ga++wva+lq qce+
  OMERI01G28810.1 539 VEHTRCRRCTVAPLYRAVTASGVAFGARRWVAALQLQCER 578
                      **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-5175223IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-8178223IPR009057Homeodomain-like
CDDcd000869.81E-4189223No hitNo description
PROSITE profilePS5084839.967342581IPR002913START domain
SuperFamilySSF559619.89E-32343578No hitNo description
CDDcd088756.60E-110346577No hitNo description
SMARTSM002341.9E-46351578IPR002913START domain
PfamPF018521.0E-44352578IPR002913START domain
Gene3DG3DSA:3.30.530.202.7E-4415542IPR023393START-like domain
SuperFamilySSF559614.67E-5600708No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 856 aa     Download sequence    Send to blast
MEELKDLRSQ LHQAADCCEK AFLDTEKKKL ILESTKGYIC DAIVAVIDHL GTVSSKLEQQ  60
LQEKIEITQT EKKLNFLKQL LEEPKRKMVL TPGRERSVAT TDSESPTTDA KSSFSFRAEA  120
GVFGRKNGPA ASGGDGVEEG DEEVQAAGEA AVEISSENAG PGCSQSQSGG GSGEDGGHDD  180
DDGEGSNKKR RRKNYHRHTA EQIRIMEALF KESPHPDERQ RQQAVQERHE NSLLKSELEK  240
LQDEHRAMRE LAKKPSRCPN CGVVAASSAA AADAATAADT REQRLRLENA KLKAEIERLR  300
GTPGKSAADG VASPPCSASA GAMQTNSRSP PLHDHDGGFL RHDDDKPRIL ELATRALDEL  360
VGMCSSGEPV WVRGVETGRD ILNYDEYVRL FRRDHGGSGD QMAGWSVEAS RECGLVYLDT  420
MQLVHAFMDV DKWKDLFPTM ISKAATLEMI SNREDDGRDG VLQLMYAELQ TLTPMVPTRE  480
LYFARYCKKL AAERWAIVDV SFDESETGVH ASSAVRCWKN PSGCLIEEQN NGRCKMTWVE  540
HTRCRRCTVA PLYRAVTASG VAFGARRWVA ALQLQCERMV FAVATNVPTR DSTGVSTLAG  600
RRSVLKLAHR MTSSLCRTTG GSRDMAWRRA PKGGSGGGGD DDIWLTSREN AGDDPGEPQG  660
LIACAAASTW LPVNPTALLD LLRDESRRPE WDVMVPGKSV QSSVNLAKGK DRTNCVTAYV  720
ARPEEEEESG GKWVLQDVCT NPCESTIAYA AIDAAALQPV IAGHDSSGVH LLPCGFISVM  780
PDGLESKPAV ITASRSTGGE ASGAGSLVTV AFQVPASSAA KATLSADSVE AVTGLVSSTL  840
RNIRKALWCD SCEEEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186193NKKRRRKN
2187192KKRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644459.10.0PREDICTED: homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLA0A0E0C8040.0A0A0E0C804_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000782-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein