PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G28450.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 193aa    MW: 20695.6 Da    PI: 6.7254
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G28450.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.1e-10138173439
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L+
  OMERI01G28450.3 138 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQ 173
                      5999****************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579591.69E-8139175No hitNo description
PfamPF001709.0E-9139173IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-10139173No hitNo description
CDDcd147031.27E-16140173No hitNo description
PROSITE patternPS000360142157IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MAQLPPKIPV AAPGHHQHWA SAGGAGDAAW ADEFAEFAAS RRGAHRRSLS DSVAFVEVAP  60
AGCGAGGEFD RLDDDQLMSM FPDEGGSSAP GSDNGGSDSD GGGDKHAAAQ SDDGQHAAGE  120
PTQEQAAATS PTELIRDPKR VKRILANRQS AQRSRVRKLQ YISELERSVT TLQVYIHIRA  180
IRTYQRRQHQ TQN
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1085530.0AK108553.1 Oryza sativa Japonica Group cDNA clone:002-144-E08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634100.14e-97basic leucine zipper 6 isoform X1
SwissprotQ5JMK63e-98BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLA0A0E0C7W41e-138A0A0E0C7W4_9ORYZ; Uncharacterized protein
STRINGOPUNC01G30390.11e-105(Oryza punctata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-19bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]