PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G28280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 556aa    MW: 61912.8 Da    PI: 5.0959
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G28280.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ430.23e-1322574741217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p p+afl+pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip+cegaatakspwna+
  OMERI01G28280.1 257 PVPAAFLRPKCALWDCPRPAQGSERWQDYCSMYHADLAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPVCEGAATAKSPWNAP 350
                      89*************************************9879*************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdl ++ege+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqps+s+ewhlyeyein++da+alyrle+
  OMERI01G28280.1 351 ELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINDCDAFALYRLEF 444
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d+kk+ak+k+++++l+++q++++rl+a
  OMERI01G28280.1 445 KSSDAKKTAKSKLACNPLNEIQQQMVRLSA 474
                      ****************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MGRGPAAGRS SAGAARHQQF RARAKTRVDD LQEMFSGLQS ARKEARSTDA AVLEAQLHQM  60
LREWRAELSG NNRELSDPPS ETLRLLQLAA AEEEEDDATS KLVEQQQQHP PSANQAHGHP  120
QAQGGQDMKP EPPEEAVASP ADLTVPQQPQ SPGQGVLASG GGMLAPAAAA VFHDQMYYVN  180
QELTVEDFLY DDNYKMYLPG YNSDVLNNLE STGQLEYPQF NLPQELPPNA YLDTSNCGQN  240
AGDVFLHMSD LLNTMSPVPA AFLRPKCALW DCPRPAQGSE RWQDYCSMYH ADLAVKEEGP  300
PGTMPVIRPR GIDLKDGPLF AALSAKIQGK HVGIPVCEGA ATAKSPWNAP ELFDLYIFEG  360
ESIREWLFFD KPRRAFESGN RKQRSLPDYN GRGWHESRKQ VMKDFGGLKR SYYMDPQPSN  420
SYEWHLYEYE INDCDAFALY RLEFKSSDAK KTAKSKLACN PLNEIQQQMV RLSADSPVEN  480
KRSARSRTKA NPNDINSNIY VVQNTTVQGS IPNAYRAVSQ PDQMTYLNGN VVYGPHLPYG  540
YSTEGSDFYW SSNDGA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417650.0AK241765.1 Oryza sativa Japonica Group cDNA, clone: J065205E23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621735.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-146VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0E0C7U50.0A0A0E0C7U5_9ORYZ; Uncharacterized protein
STRINGOMERI01G27590.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-134vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]