PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G25860.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BES1
Protein Properties Length: 682aa    MW: 76567.9 Da    PI: 5.9562
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G25860.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822125.37.5e-3940116379
           DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleea 79 
                      ++r +  +E+E++k+RER+RRai+a+i+aGLR++Gny+l++raD+neV++AL+reAGwvv +DGtt++ +s+   ++
  OMERI01G25860.2  40 GRRGRAREEKERTKLRERQRRAITARILAGLRRHGNYNLRVRADINEVIAALAREAGWVVLPDGTTFPSSSSSSVSQ 116
                      57888899************************************************************877766222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.6E-3541125IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514452.04E-188229669IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.804.6E-206232667IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.6E-114238656IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.1E-76269283IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.1E-76290308IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.1E-76312333IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060316324IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR008421.4E-8395404IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007501.1E-76405427IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.1E-76478497IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.1E-76512528IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.1E-76529540IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.1E-76547570IPR001554Glycoside hydrolase, family 14
PRINTSPR008421.4E-8550560IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007501.1E-76587609IPR001554Glycoside hydrolase, family 14
PRINTSPR008421.4E-8638652IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008421.4E-8653667IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MEEDGVKEEE EDYYLEEEDE GEEEPRPPLQ QQQQVGVGLG RRGRAREEKE RTKLRERQRR  60
AITARILAGL RRHGNYNLRV RADINEVIAA LAREAGWVVL PDGTTFPSSS SSSVSQPPPT  120
HQQLQFQRSS ASLGLIIIIM ISSPALLFLL QPGRPSIAAP PLPSSPAPPL RGISISPVAA  180
RPISSLRSSS SIRIISPPHA LPDPLLSLPS MDTQEVPDLL PPRPPERDFA GTPYVPVYVM  240
LPLGVVNGNG EVVDADVLVG QLRVLKAAGV DGVMVDCWWG NVEAHRPQEY NWTGYKRLFH  300
MIRELKLKLQ VVMSFHECGG NVGDDVSIPL PHWVTEIGRS NPDIYFTDRA GRRNTECLSW  360
GIDKERVLQG RTGVEVYFDY MRSFRVEFDE YFEDGIISEI EIGLGACGEL RYPSYPAKHG  420
WKYPGIGEFQ CYDRYLQKSL RRAAEARGHT IWARAPDSAG HYNSEPNLTG FFCDGGDYDS  480
YYGRFFLNWY SQVLVDHADR VLMLARLAFE GSDIAVKVSG VHWWYKTASH AAELTAGFYN  540
PCNRDGYASI AAVLKKHGAA LNFTCVELRT MDQHEVFPEA FADPEGLVWQ VLNAAWDAGI  600
PVASENALPC YDRDGFNKIL ENAKPLNDPD GRHLLGFTYL RLTKVLFERA NFLEFERFVK  660
RMHGEAVLDL QCLSIQVGHK KM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bfn_A1e-15823466511444BETA-AMYLASE
1bya_A1e-15823466511444BETA-AMYLASE
1byb_A1e-15823466511444BETA-AMYLASE
1byc_A1e-15823466511444BETA-AMYLASE
1byd_A1e-15823466511444BETA-AMYLASE
1q6c_A1e-15823466511444beta-amylase
1wdp_A1e-15823466511444Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0703000.0AK070300.1 Oryza sativa Japonica Group cDNA clone:J023048N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611670.10.0PREDICTED: beta-amylase 2, chloroplastic isoform X1
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A0E0C6S60.0A0A0E0C6S6_9ORYZ; Beta-amylase
STRINGBGIOSGA031300-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21413663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7