PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G22370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 231aa    MW: 25326.8 Da    PI: 8.8657
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G22370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.5e-1880133356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+ +++keq + Lee F+ n++++ +++e LA kl+L  rqV vWFqNrRa+ k
  OMERI01G22370.1  80 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQNRRARTK 133
                      67789***********************************************98 PP

2HD-ZIP_I/II1215.9e-3980167289
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E+++e+Lkr++ +l+een+rL++eveeLr+
  OMERI01G22370.1  80 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQNRRARTKLKQTEMECEYLKRCFGSLTEENRRLQREVEELRA 167
                      9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1750136IPR009057Homeodomain-like
SuperFamilySSF466892.92E-1965136IPR009057Homeodomain-like
PROSITE profilePS5007116.84475135IPR001356Homeobox domain
SMARTSM003891.2E-1577139IPR001356Homeobox domain
CDDcd000861.21E-1478136No hitNo description
PfamPF000469.3E-1680133IPR001356Homeobox domain
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
SMARTSM003407.1E-23135178IPR003106Leucine zipper, homeobox-associated
PfamPF021833.3E-10135168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MMGATSPSGL ELTMAVPGLS SSSGSEGAGC NNNNNAGGGC SMRDLDINQP ASGGEEEEFP  60
MGSVEEDEEE RGVGGPHRPK KLRLSKEQSR LLEESFRLNH TLTPKQKEAL AIKLKLRPRQ  120
VEVWFQNRRA RTKLKQTEME CEYLKRCFGS LTEENRRLQR EVEELRAMRV APPTVLSPHT  180
RQPLPASALT MCPRCERITA ATGPPTVRPP PSSAAAAAPS PFHPRRPSAA F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457270.0AF145727.1 Oryza sativa homeodomain leucine zipper protein (Oshox3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645561.11e-136PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-138HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-138HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
TrEMBLA0A0E0C5A41e-168A0A0E0C5A4_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g45570.11e-136(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.14e-59homeobox-leucine zipper protein 17