PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G18630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 418aa    MW: 44870.1 Da    PI: 7.9871
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G18630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.26.7e-3939137199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rr+C+++C la+yfpa+qp +f+n+h+lFG +n+l+++++++ee r+dam+s+vye++a++ dPv Ga+g+++ l+q+l+++kael
  OMERI01G18630.1  39 ACAACKHQRRRCTPECRLARYFPADQPVRFRNAHRLFGIKNILRVMASASEELRDDAMKSVVYESDAWVLDPVGGAAGIVKGLSQELARVKAEL 132
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      +++k+
  OMERI01G18630.1 133 DAVKR 137
                      99875 PP

2DUF260104.21.1e-322733791100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpa..eqp...kkfanvhklFGasnvlkllkal..peeeredamsslvyeAearardPvyGavgvilklqqql 87 
                      aCaaC++l+r+C+++C+la++fpa  +qp   + f+n+ +lFG+ nv+ +l a+  ++ +r+da++s++yeA+ara+dPv+Ga+gv+++l++ql
  OMERI01G18630.1 273 ACAACAHLGRACPPGCPLARCFPAagDQPaggQLFRNAFRLFGVGNVVGFLLAAggDPGKRRDAVASVAYEADARADDPVRGAHGVVMDLERQL 366
                      7*********************99665557779******************999889999********************************** PP

           DUF260  88 eqlkaelallkee 100
                      ++lkaela++++ 
  OMERI01G18630.1 367 DCLKAELATAQSA 379
                      ********99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.6438139IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-3539136IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089119.061272380IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-29273377IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MGDEEAGPSS SGHSSPTSNT STTPPPPTQP PPPPPHPQAC AACKHQRRRC TPECRLARYF  60
PADQPVRFRN AHRLFGIKNI LRVMASASEE LRDDAMKSVV YESDAWVLDP VGGAAGIVKG  120
LSQELARVKA ELDAVKRLIE LHRRAAAQQQ QQPPVAVASN GGFLPSPPPP QEQQPLFLPP  180
PPPTMMLQDG HYDDETVEDD YLVDPPAMLL RRRRRRRNAM GMDMRLLPTS RKKATSTLPP  240
LVSPPISMAQ PWRPFVADIS PVAVADVDDP PGACAACAHL GRACPPGCPL ARCFPAAGDQ  300
PAGGQLFRNA FRLFGVGNVV GFLLAAGGDP GKRRDAVASV AYEADARADD PVRGAHGVVM  360
DLERQLDCLK AELATAQSAL ARHRQYAQPP PPPPNALDRA RALNYFCHGC CGDVDGAA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210216RRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0034130.0AP003413.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1151A10.
GenBankAP0033080.0AP003308.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1129G05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638310.13e-91PREDICTED: LOB domain-containing protein 24-like
TrEMBLA0A0E0C3R70.0A0A0E0C3R7_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g39160.19e-91(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18117810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.19e-27LOB domain-containing protein 7