PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G15230.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 317aa    MW: 35584.6 Da    PI: 7.4945
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G15230.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-55141421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      lppGfrFhPtdee++++yL++k+ +++  +  +i evd++k+ePwdLp k+  ++ekewyf++++d+ky+tg r+nrat++gyWkatgkdke++
  OMERI01G15230.2  14 LPPGFRFHPTDEEIITFYLAPKIVDSRGFCVAAIGEVDLNKCEPWDLPgKAKMNGEKEWYFYCQKDRKYPTGMRTNRATEAGYWKATGKDKEIF 107
                      79********************99999555588***************544445788************************************* PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++ l+g+kktLvfykgrapkg kt+Wvmheyrl
  OMERI01G15230.2 108 RNHHMLIGMKKTLVFYKGRAPKGDKTNWVMHEYRL 142
                      *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6210172IPR003441NAC domain
PROSITE profilePS5100559.45914172IPR003441NAC domain
PfamPF023653.4E-2815142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGEQQQQVER QPDLPPGFRF HPTDEEIITF YLAPKIVDSR GFCVAAIGEV DLNKCEPWDL  60
PGKAKMNGEK EWYFYCQKDR KYPTGMRTNR ATEAGYWKAT GKDKEIFRNH HMLIGMKKTL  120
VFYKGRAPKG DKTNWVMHEY RLADASPPQP PPPSSAEPPR QDDWAVCRIF HKSSGIKKPM  180
PVAHQVPAAN YQQQMAMASA SIIQVPMQMQ MPSMSDQLKM LDDFSTGSLM APPPPPPSYS  240
TLPGFPLQIN GRAQQFVGNP SMYYQQQQQQ QMDMAAGGFV VSEPSSLVVS PQDAADQNNA  300
ADISSVACNM DATIWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-5211787174NAC domain-containing protein 19
3swp_C4e-5211787174NAC domain-containing protein 19
3swp_B4e-5211787174NAC domain-containing protein 19
3swp_A4e-5211787174NAC domain-containing protein 19
3swm_D4e-5211787174NAC domain-containing protein 19
3swm_C4e-5211787174NAC domain-containing protein 19
3swm_B4e-5211787174NAC domain-containing protein 19
3swm_A4e-5211787174NAC domain-containing protein 19
4dul_B5e-5211784171NAC domain-containing protein 19
4dul_A5e-5211784171NAC domain-containing protein 19
1ut7_B5e-5211784171NO APICAL MERISTEM PROTEIN
1ut7_A5e-5211784171NO APICAL MERISTEM PROTEIN
1ut4_B5e-5211784171NO APICAL MERISTEM PROTEIN
1ut4_A5e-5211784171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9443650.0JN944365.1 Oryza sativa Japonica Group clone KCS263E06 NAM protein mRNA, complete cds.
GenBankGU1203530.0GU120353.1 Oryza sativa Japonica Group clone KCS385F08 NAM protein mRNA, complete cds.
GenBankAK2422680.0AK242268.1 Oryza sativa Japonica Group cDNA, clone: J075186C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629856.10.0PREDICTED: NAC transcription factor ONAC010-like
SwissprotQ9FLR38e-79NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0E0C2B40.0A0A0E0C2B4_9ORYZ; Uncharacterized protein
STRINGORGLA12G0187900.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.23e-79Arabidopsis NAC domain containing protein 87