PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G13130.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 741aa    MW: 79290 Da    PI: 6.0636
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G13130.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.36.3e-124594882655
          G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +A+Pk+ilelm+ + Lt+e+v+SHLQk Rl
  OMERI01G13130.2 459 EAVPKRILELMNAEKLTRENVASHLQKCRL 488
                      79**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-11458493IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-11458488IPR006447Myb domain, plants
SuperFamilySSF466892.15E-5458492IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MNSLGRDSEE TDKGNSSEEA LRKRVQSFTE GLVKMASPVL LALKMNKVDL RSKGNAFIRG  60
SISSLAAAIL EVSIFLFLWL WLCSSQLLKD KKRKFMYTMS KMLVHFCGML LMALASCILL  120
LIIGMDKKLC LLILVPFLCI TFLSIATSAM RSEDDDASLH EEVKCEDELE RSVDFSASIT  180
ALVFLGLGRF AFEVDDPQKA DVSEHLAVAA IISFVICVLG VFFTLYGTIP LLPSINALRD  240
MELMEGGKAQ EHLQNRDSEP KKPQSAQDPA RVINPAQPQG VVEGQRKPPP ASSGETSAGQ  300
TTATSIPQPQ PAGTGSSSVD TRPASDEHPA TSTSGEEARR TAHDETTTVT SSAAQSESQP  360
DTDTTSSGET KAAPLELTKA TFTAFLLVAI PSFGDSSIHG YTHAFIFLTA AALVSGLLLR  420
LLTHRTVYPP SVVRAAKVAS FLAHLCLAAA GVCERHDAEA VPKRILELMN AEKLTRENVA  480
SHLQKCRLYL KRLRAVASQQ ASIVAAFGGR DSSLHMGAFE GLQSYQPFAP SAALPSFNPH  540
GLLSRTNTAA AFGLQELAAP SSTIQTATGN VTIGHCLEES QHGNLAQGLT AAIGKPQLQQ  600
NWIHQESNGL ALEGHSNGGQ RGQQQHHLAL PLGVSFLACV FGVSLMLIEM IPPLPGAADN  660
GDGDGYAFLM SNYTVIFDFA MAFAVSAVMW SSMHVIVELR ALLLLLPLFL ILLVRAYDVA  720
VAADAGTGGG EDEKPASMEL S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736240.0AK073624.1 Oryza sativa Japonica Group cDNA clone:J033048G07, full insert sequence.
GenBankAK1011650.0AK101165.1 Oryza sativa Japonica Group cDNA clone:J033028D10, full insert sequence.
GenBankAK1029590.0AK102959.1 Oryza sativa Japonica Group cDNA clone:J033115H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0C1I70.0A0A0E0C1I7_9ORYZ; Uncharacterized protein
STRINGONIVA12G07060.20.0(Oryza nivara)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.13e-19response regulator 12