PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G08840.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 429aa    MW: 45466.4 Da    PI: 5.7517
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G08840.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like888.8e-28209263156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k +++WtpeLH+rFv+aveqL G++kA+P++ilelm++++Lt+++++SHLQkYR++
  OMERI01G08840.2 209 KVKVDWTPELHRRFVQAVEQL-GIDKAVPSRILELMGIECLTRHNIASHLQKYRSH 263
                      5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.104206265IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-26207266IPR009057Homeodomain-like
SuperFamilySSF466894.48E-18207266IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26209263IPR006447Myb domain, plants
PfamPF002491.8E-7212261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MLEVSTLRSP KADQRAGVGG HHVVGFVPAP SPADDVADEV DAFIVDDSCL LEYIDFSCCD  60
VPFFHADDGD ILPDLEVDPT ELLAEFASSP NDEPPPTTSP PGLGEPAAAG GAKEDVKEDG  120
AAAAAADYDR SPPPPRGKKK DDEERSSSLL EEKDAKNGGD EVLSAVTTED SSAGAAKSCS  180
PSAEGHSKRK PSSSSSSAAA GKNSHGKRKV KVDWTPELHR RFVQAVEQLG IDKAVPSRIL  240
ELMGIECLTR HNIASHLQKY RSHRKHLMAR EAEAASWTQK RQMYTAAAAA AAPAPVDPAA  300
YWQQQYNAAR KWGPQAVTPG TPCMPPPLPP AAMLQRFPVP PVPGMVPHPM YRPIPPPLPP  360
QGNKLAALQL QLDAHPSKES IDAAIGDVLV KPWLPLPLGL KPPSLDSVMS ELHKQGIPKV  420
PPAASSAAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A5e-16214265657Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport (By similarity). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8340420.0CT834042.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA220E01, full insert sequence.
GenBankCT8340440.0CT834044.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI210C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615905.11e-158probable transcription factor GLK2 isoform X1
SwissprotQ5NAN51e-159GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLA0A0E0BZR50.0A0A0E0BZR5_9ORYZ; Uncharacterized protein
STRINGOMERI01G08840.10.0(Oryza meridionalis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-45GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]