PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G04770.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 207aa    MW: 21591.6 Da    PI: 11.3076
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G04770.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.3e-12113173262
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      ke  r +r+ +NR++A+  R+RKka++ eLe k+k Le  N +L +++++l++e  +l++ 
  OMERI01G04770.2 113 KEQNRLKRLLRNRVSAQQARERKKAYMTELEAKAKDLELRNAELEQRVSTLQNENNTLRQI 173
                      78899***************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-13112176IPR004827Basic-leucine zipper domain
PfamPF001707.8E-11113174IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.185114177IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-16117176No hitNo description
CDDcd147044.78E-16117167No hitNo description
SuperFamilySSF579596.25E-12117174No hitNo description
PROSITE patternPS000360119134IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MAAQEQEQEK QQAKTSTTSS LPSSSERSSS SAPNNLKEGG GNVTFSVGRP ERFGGGRGGE  60
RRGDTAGAGD GRGRRGKEDG KQQGGGGGGA AAAGGGQEQA PPARKRGRSA GDKEQNRLKR  120
LLRNRVSAQQ ARERKKAYMT ELEAKAKDLE LRNAELEQRV STLQNENNTL RQILKNTTAH  180
AGKRGGGGGG KGGDGGGGGK KHHFTKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188196GGKGGDGGG
2190199KGGDGGGGGK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032151e-163AP003215.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0089K24.
GenBankAP0149571e-163AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455099.13e-57transcription factor HY5 isoform X1
RefseqXP_015617496.13e-57transcription factor HY5
RefseqXP_025815107.13e-57transcription factor HY5-like
RefseqXP_025815108.13e-57transcription factor HY5-like
SwissprotQ9SM507e-37HY5_SOLLC; Transcription factor HY5
TrEMBLA0A0E0BXU61e-140A0A0E0BXU6_9ORYZ; Uncharacterized protein
STRINGOMERI01G04740.12e-69(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.19e-31bZIP family protein
Publications ? help Back to Top
  1. Wang F, et al.
    Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato.
    Plant Physiol., 2018. 176(2): p. 1311-1326
    [PMID:29146776]
  2. Liu CC, et al.
    The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato.
    Plant Cell Environ., 2018. 41(8): p. 1762-1775
    [PMID:29566255]