PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 32976
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family G2-like
Protein Properties Length: 1195aa    MW: 132837 Da    PI: 6.9973
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
32976genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like41.33.5e-13571624255
  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              +r+rWt e+ + F  ave+LGG + At k++ e+++ +++t+++ +S LQk+R 
    32976 571 TRRRWTAEMVADFEVAVERLGGVDAATGKKLAEALSAHDVTRDQCASRLQKHRE 624
              79**************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005452.4E-153374IPR003349JmjN domain
PROSITE profilePS5118315.2273475IPR003349JmjN domain
PfamPF023751.9E-153568IPR003349JmjN domain
SMARTSM005581.9E-45178344IPR003347JmjC domain
PROSITE profilePS5118435.131181344IPR003347JmjC domain
SuperFamilySSF511971.18E-30190344No hitNo description
PfamPF023731.1E-37211327IPR003347JmjC domain
PfamPF029282.8E-10429481IPR004198Zinc finger, C5HC2-type
SuperFamilySSF466899.85E-10569628IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-12570627IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-9572625IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1195 aa     Download sequence    Send to blast
MSARRDVDAR HASTSEKDSE RKPSRTTTAD IASAPTFRPT LEEFADPIAY LSSIEARARE  60
AGICKVIPPR GAAPRWNGEA WRRDDARFET KLQNVHSLSE GRTFQFGKEY AKGEYEAMAK  120
AYEERWAKER PDVDANDANA LERAFWDMVE TRSEQARVEY GNDLDTKIFG TGFGVDENGE  180
KHPWDFEHLY SHPLNLLRVV EHDIPGLTKP WLYLGMLFAT FCWHVEDHFL CSLNYLHRGA  240
AKTWYGVPGS DAEAFENCAR ATVPRLFEQA PDILHQIVTI VPPGVLVDHG VKVVHTVQQP  300
GEFVVTFPRA YHAGFSHGFN VAEAVNFGHV NWLDFGRRAI DVYSTGSFKR NAVFAHHRLV  360
SRAAETFVEV LGKNARLVKS KAMGAIVSTL RKELETILSD EEIYRASLVR RGLNIEIVQA  420
PNEDDDACCI RCKAMPFLSV VRCKCLPTAV RCLRHAMDAC DCAAGERTLE IRVVDSRLRE  480
LIKALFFGDG IQTKNDAAKA RVDFSANVNR VAVNRAPPPK PKVVLPKPKT VKPPPTRAVL  540
ASPPPTRIVA SKADDAFTAR GLPRKRAKCE TRRRWTAEMV ADFEVAVERL GGVDAATGKK  600
LAEALSAHDV TRDQCASRLQ KHREKIKSNA DARATFMASK RPRGDATDAS TPRARVSEED  660
ARAPVSLKSL LERWNLGDVV NTAGVSRRIK CRLVPVCRTK DDERARIARG EPVICASAEY  720
ASEVFDAIGT ARDGLAWATR SSFSNFDAER GKVAMRSGWG APGTHVLSNR DMTIVTSFAE  780
VVDPANEKPL NLQMFHREDT AVPVLSRKLK WPSEEEFFGI EGEDAPGRLL DDATRVSARG  840
AMTWWHLDDC GEFVCQVGLP EAGEAAEDVL LGPTGKPVVK LFIFAQRKDY AWVAQDAEMN  900
KSYKNCALDL FDTPDHYYPT ASEMCHPSSA PLDVSSPKAF DGAATSDDAE DPCPTFWVAP  960
LEAGGPPLLS PPNIIHCVLT VRDCVMCEER RLSLAYMDEV LYFQRRAARW CEPPIFYAFV  1020
REDLSDTEKA RSNAMRPLVK MLNDLKRVGA TDGDAYRFAR CLTSLRVLAN HSPEFYALDA  1080
DGVAEARKSI DKLESWLADD SNCEFVEKIQ AAVKADPRAV EDAELAESMM SETLGVLNLA  1140
DGRSCAVVHE RGRPRWGPVR NSKSLVDKDR KDMKNAIRSG TLDALLLAYR RDII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a1f_A3e-91345029475LYSINE-SPECIFIC DEMETHYLASE 5B, LYSINE-SPECIFIC DEMETHYLASE 5B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005880.0CP000588.1 Ostreococcus lucimarinus CCE9901 chromosome 8, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001419094.10.0predicted protein
TrEMBLA4S1520.0A4S152_OSTLU; Uncharacterized protein
STRINGABO973870.0(Ostreococcus 'lucimarinus')
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48430.12e-48relative of early flowering 6