PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 26932
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family G2-like
Protein Properties Length: 365aa    MW: 38517 Da    PI: 5.3334
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
26932genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.39.4e-30118171255
  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              +rlrWtpeLH++F++av+qLGG e AtPk i+++m + g+t++h+kSHLQkYRl
    26932 118 ARLRWTPELHREFINAVNQLGGLELATPKGIMHIMAMSGMTIQHIKSHLQKYRL 171
              69***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-27118172IPR009057Homeodomain-like
SuperFamilySSF466894.12E-14118172IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-23118172IPR006447Myb domain, plants
PfamPF002491.5E-6119170IPR001005SANT/Myb domain
PfamPF143792.3E-12303344IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MADERFWPLF EGLAGAGDGA LDGAVDDTLD WLDDVIVRGA TSGRVEDEDA LGEDAAEDDD  60
DARDGTRAND GRGGGRKRAR ASGDARASTS GQEKRAKANA GRGKEGNATR GRNGRGGARL  120
RWTPELHREF INAVNQLGGL ELATPKGIMH IMAMSGMTIQ HIKSHLQKYR LQEGAGGSRG  180
AELDAEADRE RRAMIKRARV QQQAEMKQRA SEADLMGLDV ASAAPMGSGL SSDPPSTPVT  240
TAQLSELLNS TSAMKAKTLG SEGKIHALDA ILAQALKPAA TLSDEAAAAV VSAELIEDMP  300
HVGHALLKQL EMQKQLHDQL IAQRRLQTAI EEHGKYLASI LAQEVSGKTK PPEAALGDDA  360
VDGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-19116170155Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17480GRKRARA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005920.0CP000592.1 Ostreococcus lucimarinus CCE9901 chromosome 12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001420857.10.0predicted protein
TrEMBLA4S5Z30.0A4S5Z3_OSTLU; Uncharacterized protein
STRINGABO991500.0(Ostreococcus 'lucimarinus')
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.35e-18myb-related protein 1