PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 26838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family G2-like
Protein Properties Length: 256aa    MW: 27602.7 Da    PI: 9.942
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
26838genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.4e-29109162155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              ++rl+Wtp+LH++F+ av++L G + A+Pk+i+++m+vkgLt+e+v+SHLQkYRl
    26838 109 RQRLVWTPQLHAQFIAAVQKL-GVKTAVPKAIMKIMNVKGLTRENVASHLQKYRL 162
              58*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.517106165IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-29107166IPR009057Homeodomain-like
SuperFamilySSF466893.58E-19107166IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-24110162IPR006447Myb domain, plants
PfamPF002491.7E-8112161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MTVYPAVYGA YDAMRAMSPM TYDAYAGAAR AVAVPGDSFS RQIQERAYAS AFTFTRQWNY  60
LQHAAAAQHA AFASGSRGGG TMMDLLAATG SAAAERDIGV EREVELSKRQ RLVWTPQLHA  120
QFIAAVQKLG VKTAVPKAIM KIMNVKGLTR ENVASHLQKY RLTLKRAQDS SESTRASGDA  180
TDAKRSDVRA GRKRKDREEK GKTNSGSGQG SGQGSDGGSA EHSASENLEN RAKRISSSEE  240
EETRQITLAV DHNDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-24109165157Transcription factor LUX
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005920.0CP000592.1 Ostreococcus lucimarinus CCE9901 chromosome 12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001420647.10.0predicted protein
TrEMBLA4S5P70.0A4S5P7_OSTLU; Uncharacterized protein
STRINGABO989400.0(Ostreococcus 'lucimarinus')
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.12e-28G2-like family protein