PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN541090.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 616aa    MW: 68923.4 Da    PI: 6.0214
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN541090.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.46.5e-1112366081374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts    ++ l+a++l+  +  + k
  KN541090.1_FGP001 236 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLVAKRTS---AVDILQAYQLYMAAICFKK 324
                        6789***************************************************999999999999998...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        +s++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++R+Tg++ p++g   +e++eetg+rL+k+A+e+gvpf++n+++
  KN541090.1_FGP001 325 VSFIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRMTGIDLPQPGfrPTERIEETGHRLSKYAQEFGVPFKYNAIA 416
                        ************************************************************9*****************************99 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a ++e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+
  KN541090.1_FGP001 417 AVKMESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDAT 508
                        99****************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                         prese+r+ +E+ ++gr++ nv+aceg +r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r 
  KN541090.1_FGP001 509 TPRESEQRMLIEQNIFGRAALNVIACEGIDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQVVRNKVKDCYHKDFVIDIDHQWLLQGWKGRI 600
                        ***********************************************************************889****************** PP

               GRAS 367 LvsvSaWr 374
                        L+++S W+
  KN541090.1_FGP001 601 LYAISTWT 608
                        *******5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.777210588IPR005202Transcription factor GRAS
PfamPF035142.2E-108236608IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MVKQGEEAPE DLVLPFISRM LMEEDIDDKF FYDYPDNPAL LQAQQPFLEI LSDPSSNSRS  60
SNSDDPRLSP TSSSDTSAAI NSYDATATAT AVAASAAVPV PQYESIELDP AAFFAAANSD  120
LMSSAFLKGM EEANKFLPTE NKLVIDLEAS SENNYLRGLE EAKRFLPSDD KLQVGFAAAA  180
APVVMMPSHE NCTEMMEKLR IAMKEEAAKN EASAGGKGGN GKVKGGRRGG RDVVDLRTLL  240
IHCAQAVATD DRRSATELLK QIKQHAKPTG DATQRLAHCF AEGLQARIAG TGSLVHQSLV  300
AKRTSAVDIL QAYQLYMAAI CFKKVSFIFS NQTIYNASLG KKKIHIVDYG IQYGFQWPCF  360
LRRISQREGG PPEVRMTGID LPQPGFRPTE RIEETGHRLS KYAQEFGVPF KYNAIAAVKM  420
ESVRKEDLNI DPDEVLIVNC QYQFKNLMDE SVVIDSPRDI VLSNIRKMQP HVFIHAIVNG  480
SFSAPFFVTR FREALFFYSA LFDVLDATTP RESEQRMLIE QNIFGRAALN VIACEGIDRV  540
ERPETYKQWQ VRNQRAGFKQ LPLNPEIVQV VRNKVKDCYH KDFVIDIDHQ WLLQGWKGRI  600
LYAISTWTPN DALSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-452406078374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1219430.0AK121943.1 Oryza sativa Japonica Group cDNA clone:J033107F03, full insert sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0E0BUD20.0A0A0E0BUD2_9ORYZ; Uncharacterized protein
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-160GRAS family protein