PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN540204.1_FGP005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family EIL
Protein Properties Length: 513aa    MW: 57379.6 Da    PI: 6.2889
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN540204.1_FGP005genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3146.63.3e-45381361100
                        XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
               EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                        eel +rmwkd+++lkr+ker+++l + ++aa++++k++k++eqa rkk++r QDgiL+YMlk mevcna+GfvYgiip+kgkpv+gasd++r
  KN540204.1_FGP005  38 EELARRMWKDKIKLKRIKERQQKL-ALQQAALEESKTKKMSEQALRKKTARVQDGILRYMLKLMEVCNARGFVYGIIPDKGKPVSGASDNIR 128
                        8********************986.577778************************************************************* PP

                        XXXXXXXX CS
               EIN3  93 aWWkekve 100
                        aWWkek+ 
  KN540204.1_FGP005 129 AWWKEKIT 136
                        ******96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048738.1E-4438136No hitNo description
PRINTSPR001311.3E-8367375IPR001360Glycoside hydrolase family 1
PfamPF002325.8E-18459512IPR001360Glycoside hydrolase family 1
Gene3DG3DSA:3.20.20.807.0E-22459512IPR013781Glycoside hydrolase, catalytic domain
SuperFamilySSF514451.93E-21459512IPR017853Glycoside hydrolase superfamily
PRINTSPR001311.3E-8461478IPR001360Glycoside hydrolase family 1
PRINTSPR001311.3E-8485497IPR001360Glycoside hydrolase family 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MGNPSILTED LGDTSDFEVD GVENLTENDV SDEEIDAEEL ARRMWKDKIK LKRIKERQQK  60
LALQQAALEE SKTKKMSEQA LRKKTARVQD GILRYMLKLM EVCNARGFVY GIIPDKGKPV  120
SGASDNIRAW WKEKITHRSS REGKSDDTYS SSDEYDVDHL EEPPHSSSSK DDAGRCQPTA  180
QIREERRHNR GRHDQQPNQV LPSNEGTNES RKRKRPSGHL LTAESEVEVT QKDDNQLAIV  240
SNALPNMSRI NQTEMMDMAN QMTSLSHVNT TGTLQHQYVQ GNFVSSPAAV VNNYNSNQIT  300
NVNPSRIYMG YQPLACQNNG HTNPWSGNTF QVDVGPPPIG FTTNSSSGGN HSLPMKQSLP  360
ESIDDHVPIT ETGVLADSSP YGYHITATGS RNSTSVAGHG NQLMGDPFDS GTADKFNGNS  420
FDGLPFDFIG SSPIPDIGAT LLQLHILLEL TSRNVKGGRE GVKVKGYFTW TFMDDFEWGD  480
GYTGRFGLIY VDRETLKRYR KKSSYWFADF LKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wq4_A4e-14461513454507Beta-primeverosidase
3wq4_B4e-14461513454507Beta-primeverosidase
3wq5_A4e-14461513454507Beta-primeverosidase
3wq5_B4e-14461513454507Beta-primeverosidase
3wq6_A4e-14461513454507beta-primeverosidase
3wq6_B4e-14461513454507beta-primeverosidase
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN540204.1_FGP005
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648717.10.0ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0E0ENB60.0A0A0E0ENB6_9ORYZ; Uncharacterized protein
STRINGOMERI08G16520.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.12e-41ETHYLENE-INSENSITIVE3-like 3