PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539566.1_FGP003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family FAR1
Protein Properties Length: 415aa    MW: 45653.2 Da    PI: 5.5832
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539566.1_FGP003genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1287.1e-091251635190
               FAR1  51 errtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         + +r+etr++C+a++k+++  dg + v++++ eH+H+la
  KN539566.1_FGP003 125 DSFSRPETRCKCQACMKISLI-DGLYSVYHFVPEHSHNLA 163
                        556899***************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.8E-5125163IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MVGEPSEATR RMGSPQGGGE GEVGEDDNKG GPVGGGWGDK RQQRGGAEGT TSILDDPSAP  60
TFGDLDESKD PSDGILDDTS APTFRNLDES KDPPDGLGRN QLEDFIEIIG TRGTDKRAEA  120
AGYGDSFSRP ETRCKCQACM KISLIDGLYS VYHFVPEHSH NLATKSQAHQ LRSQRKINEA  180
QVASVEVAKS VGISTKAAID LMAKQACGFE NLGFTRVDMK NKLVGDKRYE EVKCDFKATQ  240
STPKLKAELR ILRDVAEVYT PAVYKIFEEE VMQTLNCDIF YCGDVDAEKV YKIKMASKPK  300
GIKLKRKEIR GSARPIGGLE KSSQKRKKKK NEDSPAEVVE LQPVTEMQPQ PYATVLGNLE  360
VPNDQAFLHV SQYYAALDAS TSNPTRVSMT PENQGLHQQG RSIQQFDTDL YNLFN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0010810.0AP001081.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0693B08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700788.13e-40PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
STRINGLOC_Os01g16660.11e-105(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-09FAR1-related sequence 5