PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539559.1_FGP011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family YABBY
Protein Properties Length: 91aa    MW: 10189.5 Da    PI: 9.2896
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539559.1_FGP011genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY125.86.2e-391772115170
              YABBY 115 virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                            PekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  KN539559.1_FGP011  17 DGDAPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 72 
                        4568**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.9E-371072IPR006780YABBY protein
SuperFamilySSF470953.53E-82066IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.5E-52264IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MAACVAGERA EQQPVQDGDA PEKRQRVPSA YNRFIKDEIQ RIKAGNPDIS HREAFSAAAK  60
NWAHFPHIHF GLMSDHQGLK KTSLLPQVTN Q
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539559.1_FGP011
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2740151e-107AB274015.1 Oryza sativa Japonica Group OsYABBY3 mRNA for OsYABBY3 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464399.11e-42protein YABBY 3
RefseqXP_025876472.11e-42protein YABBY 3 isoform X2
SwissprotQ8L5561e-43YAB3_ORYSJ; Protein YABBY 3
TrEMBLA0A0E0EZR23e-41A0A0E0EZR2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0M9I83e-41A0A0E0M9I8_ORYPU; Uncharacterized protein
TrEMBLA0A287FEU67e-42A0A287FEU6_HORVV; Uncharacterized protein
TrEMBLB9G6J81e-41B9G6J8_ORYSJ; Uncharacterized protein
TrEMBLC5WWB53e-41C5WWB5_SORBI; Uncharacterized protein
STRINGOMERI10G11930.15e-42(Oryza meridionalis)
STRINGOPUNC10G13730.15e-42(Oryza punctata)
STRINGSb01g017560.14e-42(Sorghum bicolor)
STRINGTraes_1DL_C5AF9D06A.14e-42(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144538121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.13e-38YABBY family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]